KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 101178913
Entry
101178913         CDS       T03265                                 
Symbol
TP53AIP1
Name
(RefSeq) LOW QUALITY PROTEIN: p53-regulated apoptosis-inducing protein 1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04115  p53 signaling pathway
nle04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101178913 (TP53AIP1)
   04115 p53 signaling pathway
    101178913 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 101178913
NCBI-ProteinID: XP_030685586
LinkDB
Position
15:6002211..6002584
AA seq 124 aa
MRRSQVLCFLQTGSPLEGSSSKASFRSAQASCRGARRQGLGRGDQSLLVMPPNGRAQTHT
PGWVSPRSENQDGLLPATXPGRLCSHRGAHIPSFQTHQDPVTASGSSELHGDCPQFRALD
GAGN
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaggagaagccaagttctctgctttctgcagacagggtctcccctggaggggtcttcc
tctaaggcgagcttcagatctgctcaagcttcctgccgtggggccaggaggcagggcctg
ggcaggggagaccagagcctcttggtgatgcctccgaatggcagggctcagacacacaca
ccgggctgggtaagtccccgcagtgaaaaccaagatggtcttttgcctgccacgngcccc
ggcagactctgctctcaccgtggtgcccacattccaagttttcagacccaccaggaccca
gtgacagcatctgggtcctcggagctgcatggggactgtccccagttcagggcattggac
ggagctgggaactga

DBGET integrated database retrieval system