KEGG   Natrialba magadii: Nmag_1167
Entry
Nmag_1167         CDS       T01176                                 

Definition
(GenBank) GalE family epimerase/dehydratase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
nmg  Natrialba magadii
Pathway
nmg00053  Ascorbate and aldarate metabolism
nmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Nmag_1167
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     Nmag_1167
SSDB
Motif
Pfam: Epimerase RmlD_sub_bind NAD_binding_4 NAD_binding_10 Polysacc_synt_2 3Beta_HSD GDP_Man_Dehyd DapB_N Semialdhyde_dh
Other DBs
NCBI-ProteinID: ADD04751
UniProt: D3SS25
LinkDB
Position
1191075..1191845
AA seq 256 aa
MTNVAITGATGRVGGETIEAFANREETLTLFSHSEPDDLEATPIEIGNREEVMDALDGQD
IVVHLAANPDPRAEWDAVQEPNIEGVYNVYAAAVEHDLQRVVFASSNHAVNMDNTVSPTR
PESTIGTPTAVQPDDPMDPDTYYGVTKVFGEAMGSYYANRHGLDVINLRIGWLLSREELA
DEIADRDGPGERYARAMWLSPDDCQRLMKAAVTSSLPNTPVTAHGISNNSERFLSLTETM
LALEYQPQDDSARVLE
NT seq 771 nt   +upstreamnt  +downstreamnt
atgacgaacgttgcgatcactggagcaaccggccgggtcggcggggagactatcgaggcg
ttcgcgaaccgcgaggaaacactcacgctcttctcgcacagtgaacccgacgacctcgag
gcgaccccaatcgaaatcggcaatcgcgaggaggtcatggacgcactcgacggacaggat
atcgtcgttcacctcgcagccaaccccgatccgcgcgccgagtgggatgcagtgcaagaa
ccgaatatcgaaggtgtctacaacgtctacgcggccgcagtcgaacacgacctccagcgc
gtcgtctttgcgagttcgaaccacgcggtcaacatggataacaccgtctcacccacccgc
ccggagtcgactattggcacgccgaccgccgtccaaccggacgatccgatggacccagac
acgtactatggcgtcaccaaggtcttcggcgaggcgatggggtcctactatgccaaccga
cacggcctggacgtgatcaatctccgaatcggctggcttctctcacgtgaagaactggca
gacgagattgccgaccgcgacggtcccggcgaacgctacgcccgcgcgatgtggctcagc
cccgatgactgccaacgactcatgaaggctgccgtgacgagttcgctcccgaacacaccg
gttaccgcccacggcatctcgaacaactccgaacgattcctctcgctcaccgaaaccatg
cttgcactcgagtaccagccacaggacgattcggcgcgggtactcgagtag

DBGET integrated database retrieval system