KEGG   Nelumbo nucifera (sacred lotus): 104604446
Entry
104604446         CDS       T04131                                 
Name
(RefSeq) (S)-canadine synthase-like
  KO
K13395  (S)-stylopine/(S)-canadine/(S)-nandinine synthase [EC:1.14.19.64 1.14.19.68 1.14.19.73]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00950  Isoquinoline alkaloid biosynthesis
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    104604446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nnu00199]
    104604446
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.64  (S)-stylopine synthase
     104604446
    1.14.19.68  (S)-canadine synthase
     104604446
    1.14.19.73  (S)-nandinine synthase
     104604446
Cytochrome P450 [BR:nnu00199]
 Cytochrome P450, plant type
  CYP719 family
   104604446
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 104604446
NCBI-ProteinID: XP_010267084
UniProt: A0A1U8AVU0
LinkDB
Position
Un
AA seq 495 aa
MQGNQGLILASVIFVVAIVQMMIRKRRTSPTAMKWPAGPRKLPIIGNMHQLSRADGLFHV
ALTKLAKVHGSVMTIWLGSWRPTIVVSDDEVAWEVLVNKSSDYAARDHPYIDKIMWAGAR
TIHTSDASPHWHSLRKGLQSGGLGPLSISGQTHLQEKDIAQMLRDMREEASLNGGLVKPF
HHIRRTSVRLLCRLCFGPNFEDAKFSEAIDKAIEDIIRISGVGYLADAFFFGRHFPGLKH
TFQEACDLKRRVEDLIRPFLRAVPPPNCYLHFLLSNNIPEDVTIFTILEVFTLGIDSTSS
TATWALALLTNEQRVQQKLYQDIKKNIDSTQQIVRVEDVSKLQYLQAAVKETLRLKPVAP
LVPHMTATETTLMGTKVAQGTRVVVNLHAIHYNPNVWPEPEKYMPERFMPRQEEVDEIRP
GTTKLSYFLPFGGGMRACAGMEVGKLHVGFVIANIVNAFQWSSAVEGQPPDLTEDFKFVL
LMKNPLTVRITARHP
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgcagggcaatcagggtttaattcttgccagtgtaatcttcgtggtcgcaattgtacag
atgatgattcgaaagcgaagaacgtcgcccactgccatgaaatggccggcaggacccagg
aaattgcccatcataggtaacatgcaccaactatctagagccgatggcttgtttcatgtg
gccctaaccaaactggccaaagttcatgggagtgtgatgaccatctggcttggtagctgg
cggcccactattgttgtgagcgacgacgaggtggcttgggaggtgttggtgaacaagtcc
tcagactacgctgctcgtgatcatccttacattgacaagatcatgtgggcaggggctcgc
accatccacacatctgacgccagcccccactggcacagtcttcgcaagggccttcaaagc
ggtggcctaggccccctcagcatctccggccaaacccacttgcaagaaaaagatattgca
cagatgctccgagacatgcgtgaagaggcctccctcaacggtggccttgtcaagcctttt
caccatattcgccgtacctcggtgcgtttactatgccgcctttgcttcggccccaacttt
gaagatgccaagttctccgaagcaattgataaagccattgaagatatcatccgcatcagt
ggcgttggctatctggccgacgccttcttcttcggccgacacttccccggcctcaagcac
acattccaggaggcatgcgacctgaaacgccgagtcgaggatttgatacgcccttttctc
agagcagttcctcctccaaactgctatttgcacttccttctttccaataacatccccgaa
gatgtcaccatattcaccatcttagaggtattcacactcggcatcgatagcacctcctcc
accgcaacttgggcacttgctcttttgaccaatgagcaacgagtccaacaaaaactctac
caagacatcaagaagaacatagacagtacccaacaaattgtgagggttgaggatgtaagc
aagctgcaatatttacaagcggctgtgaaggagacgttgagattgaagcctgttgctcct
ttggtgcctcacatgactgccacagagaccactctgatgggaacaaaggtggcacaaggt
accagagtggtggtaaaccttcacgctatacactataatccaaatgtgtggccagaaccg
gagaagtacatgcctgagcggttcatgcctcgtcaagaagaggttgatgaaatacggccg
ggaaccacgaaactatcttatttccttccatttggaggtggaatgagagcttgtgcagga
atggaggtagggaagcttcatgtagggtttgtaatagctaacatagttaatgcctttcaa
tggtctagtgctgtcgaggggcaaccccccgatttgaccgaagacttcaagtttgtgctc
ctcatgaaaaatccacttacagtgcgcatcactgctcgtcacccttga

DBGET integrated database retrieval system