KEGG   Nonomuraea sp. ATCC 55076: BKM31_22770
Entry
BKM31_22770       CDS       T04759                                 

Name
(GenBank) cytochrome
  KO
K21146  vitamin D 1,25-hydroxylase [EC:1.14.15.22]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00100  Steroid biosynthesis
noa01100  Metabolic pathways
noa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    BKM31_22770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:noa00199]
    BKM31_22770
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.22  vitamin D 1,25-hydroxylase
     BKM31_22770
Cytochrome P450 [BR:noa00199]
 Cytochrome P450, bacteria type
  CYP105 family
   BKM31_22770
SSDB
Motif
Pfam: p450 DDR_swiveling
Other DBs
NCBI-ProteinID: AQZ63906
UniProt: A0A1V0A111
LinkDB
Position
complement(5066713..5067900)
AA seq 395 aa
MTTAPPAFPQARVCPHLPPPAYAELRQGPALRRVTTYAGQLAWLVTRYDQARTLLKDPRL
SSDRRRPGFPVISVQVELLTERKRQALIGMDPPEHDIQRRMFLPDFTLKKVRERRADIER
IVHESLDDMLAQGPPADLYRDFALPVPFRVICRLLGAPWEDRDFFQDAIRRLVRTFSTEE
GRQAGAELLAYFEHLVTEYKKTPDGAGLIGRLAGTGRISDDDLALAAMSLLIAGHETTAA
MISLGAVTLMENPDQLAAIRADPEAIVPAVEELLRYQSIADSANIRVATADIEIDGVVIK
AGEGVLVPASLANRDAEVFENPDVFDAGRDAGGHIAFGYGRHQCLGQNLARLELQIALTA
LWQRIPTLRMTVPAEELAPRPPGAIQGIDALPVTW
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaccacagcaccgcccgccttcccgcaggcccgcgtctgcccgcaccttccacccccg
gcgtacgcggagctgcggcagggcccggcgctgcgccgggtgaccacctacgccggccag
ctcgcgtggctggtcacccggtacgaccaggccaggacgctgctgaaggaccccagactc
tcgtccgaccgcaggcgccccggcttccccgtcatctcggtgcaggtcgagctgctgacc
gagcgcaagcgccaggcgctgatcggcatggacccgccggagcacgacatccagcggcgg
atgttcctgccggacttcacgctgaagaaggtccgcgagcggcgggccgacatcgagcgc
atcgtgcacgagtcccttgacgacatgctggcgcagggcccgcccgccgacctgtaccgg
gacttcgccctgccggtgcccttccgggtgatctgccgcctgctcggcgccccctgggag
gaccgcgacttcttccaggacgccatcaggcggctcgtgcggaccttctccacggaggag
ggccgccaggcgggcgccgagctgctcgcctacttcgagcacctggtgaccgagtacaag
aagaccccggacggtgccggcctcatcgggcgactggccggcaccggccggatctccgac
gacgacctcgcgctggcggccatgtcgctgctcatcgcgggacacgagaccaccgcggcg
atgatctccctcggcgcggtcacgctcatggagaacccggaccagctcgccgcgatccgg
gccgaccccgaggcgatcgtgcccgccgtggaggagctgctgcgctaccagtcgatcgcc
gacagcgccaacatccgggtcgccaccgccgacatcgagatcgacggggtggtgatcaag
gcgggggagggcgtcctcgtccccgcctcgctggccaaccgggacgccgaggtcttcgag
aacccggacgtcttcgacgccggccgcgacgccggcgggcacatcgccttcggctacggc
cgccaccagtgcctcggccagaacctggcccggctggagctgcagatcgcgctgacggct
ctgtggcagcgcatcccgacgctgcgcatgaccgtgcccgcggaggagctggcgccccgc
ccgccgggcgcgatccagggcatcgacgcgctgccggtcacctggtga

DBGET integrated database retrieval system