KEGG   Nocardia sp. CS682: DMB37_03450
Entry
DMB37_03450       CDS       T06040                                 

Name
(GenBank) cytochrome P450
  KO
K21146  vitamin D 1,25-hydroxylase [EC:1.14.15.22]
Organism
noz  Nocardia sp. CS682
Pathway
noz00100  Steroid biosynthesis
noz01100  Metabolic pathways
noz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DMB37_03450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:noz00199]
    DMB37_03450
Enzymes [BR:noz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.22  vitamin D 1,25-hydroxylase
     DMB37_03450
Cytochrome P450 [BR:noz00199]
 Cytochrome P450, bacteria type
  CYP105 family
   DMB37_03450
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QBS39315
UniProt: A0A4P7GZ29
LinkDB
Position
complement(803644..804864)
AA seq 406 aa
MSDPVAPPRTDQAPAYPSDRTCPYQLPEQYSRLRDGDDSLRRVTLFDGRPAWVVTKHETA
RVLLGDPRLSSDRSHPNFPAVSPRFQLFRNRPRMFIALDPPEHTVKRRMLISEFTVKRIK
RMRADIERIVHGCVDDLLAAGPPADLVGRFALPVPSLVICRLLGVPYADHELFRDASGRI
VHGTTAAEAIGARAEVETYLDGLITRLQKEPGTGLLSALAAEQLAHGGIDRAELVATAML
LLVAGHETTASMIALSVITLLAHPDQHAALRADPSLIPGAVEELLRYLAIADVGGGRFAT
ADIEIDGHLIRAGDGVIVSNAIANRDGSVFADPDTFDVHRSARHHLSFGYGVHQCLGQNL
ARLELEIALAALFERIPTLRVAVPVAQLILRPGSTIQGVNELPVTW
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtccgaccctgttgcgccgccccgaaccgatcaagcccccgcctacccgagtgaccgg
acctgtccttatcagctaccagagcagtattcccgactccgggacggcgacgactcgctg
cgccgggtgaccctcttcgacggccgcccggcctgggtggtcaccaagcacgagaccgcc
cgcgtgctgctcggcgacccgcggctttcctcggatcggtcgcatccgaatttccccgcg
gtgtcgccgcgcttccagctgttccggaaccgcccgcggatgttcatcgccctcgatcca
ccggaacacaccgtcaagcggcggatgctgatcagcgagttcacggtgaagcggatcaag
cggatgcgggccgacatcgagcgcatcgtgcatggttgcgtcgatgatctgctcgccgca
ggaccgcccgccgacctcgtcggccggttcgcgctgccggtgccgtctctggtgatctgc
cgactgctcggggtgccgtacgcggaccacgaattgttccgggacgcgagcgggcggatc
gtgcacgggaccaccgcggcggaggcgatcggcgcgcgggcggaagtcgagacctatctg
gacgggctgatcaccaggttgcagaaagaaccgggtaccgggctgctgtccgcgctggcc
gccgagcaactggcgcacggcggtatcgatcgggcagaactggtcgcgaccgcgatgttg
ctgctggtcgcaggccacgagacgacggcatcgatgatcgcgctttcggtgatcaccctg
ctggcccaccccgatcagcacgccgccctgcgcgcggaccccagcctcattccgggtgcg
gtcgaagaactgctgcgctacctggccatcgccgacgtcggcggcggtcgattcgcgacg
gccgacatcgagatcgacggccacctgatcagggcgggcgacggcgtgatcgtcagcaat
gccatcgccaaccgcgacggctcggtcttcgccgatccggacaccttcgacgtgcaccga
tcggcccgccaccacctctcgttcggctacggcgtacaccagtgcctcggccagaacctg
gcccggctggaactcgagatagccctcgcggcgctgttcgaacgcatcccgacgttgcgc
gtagccgtgcccgtggcacagctgatcctgcgaccaggctcgacaattcaaggcgtgaac
gaacttccggtcacctggtga

DBGET integrated database retrieval system