KEGG   Nothoprocta perdicaria (Chilean tinamou): 112952138
Entry
112952138         CDS       T07556                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
npd  Nothoprocta perdicaria (Chilean tinamou)
SSDB
Motif
Pfam: MRAP FixQ PDR_CDR
Other DBs
NCBI-GeneID: 112952138
NCBI-ProteinID: XP_025900733
LinkDB
Position
Unknown
AA seq 120 aa
MANRTNASEYFWSYEYYWDYIDPIPVDGRKLKVNKYTIVIAFWVGLAAFVMFLFLILLYM
SRSGSTPIKQVFARRQAEESSSNGEQPHCDDHSSPDSDLIAPETPNALSGQTGIHGSISA
NT seq 363 nt   +upstreamnt  +downstreamnt
atggctaacagaacaaacgcttccgagtatttctggtcttacgaatattactgggattac
atagacccaattccagtagatggaaggaagttgaaggttaataaatatactatcgtcata
gccttttgggttgggcttgctgcatttgtgatgtttctcttccttattttgctttatatg
tcccgctccggatcgacaccaatcaaacaggtgtttgcaaggagacaggcagaagaaagc
agctccaatggtgaacagcctcactgcgatgaccacagtagcccagactcagatttgatt
gctcccgaaacaccgaacgccctttcagggcaaactggcattcatggaagtatctcagcc
tga

DBGET integrated database retrieval system