KEGG   Natrinema pallidum: FGF80_04025
Entry
FGF80_04025       CDS       T06072                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
npl  Natrinema pallidum
Pathway
npl00053  Ascorbate and aldarate metabolism
npl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    FGF80_04025
Enzymes [BR:npl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     FGF80_04025
SSDB
Motif
Pfam: Epimerase Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind NAD_binding_10 3Beta_HSD GDP_Man_Dehyd DapB_N
Other DBs
NCBI-ProteinID: QCW02447
UniProt: A0A4P9TCZ8
LinkDB
Position
827284..828060
AA seq 258 aa
MTAIAITGASGTVGREAIAAFPDDDHELTCFSHSETDDLDTQPLEIKDREAFASALEGQD
VLLHLAANPSPRAEWDEVRGPNIGGVYNAFEAAIEHDLQRVVFASSNHAVNMRNTVSGIR
PESTVGRPAIVRPDDPADPDTYYGVTKVFGEAMGSYYAKRHGLEVVNLRIGWLLTRDDLR
RECQERDGAGERYARAMWLSPDDCRRLLNAAVTATLGGSPLTAHGISANAERFLSLSETM
RDLGYRPRDDAETVLNDE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgacggccatcgcaatcaccggcgcatcggggaccgtcgggagggaagccatcgcggcg
tttccggacgacgaccacgaactcacgtgcttctcacacagcgagaccgacgacctcgac
acccagcccctcgagatcaaggatcgcgaagcgttcgcgagcgcgctcgagggccaggac
gtgttgctccacctcgcggcgaatccgtcgccgcgggccgagtgggacgaggtgcgaggg
ccgaacatcggcggcgtctacaacgcgttcgaagcggcgatcgagcacgacctccagcgg
gtggtcttcgcgagttcgaaccacgcggtcaacatgcgaaacaccgtctcgggaatccgg
ccggagtcgaccgtgggccgtccggccatcgtccgacccgacgatccggcggaccccgac
acctactacggcgtcaccaaggtcttcggcgaagccatgggatcgtactacgcgaagcgc
cacggcctcgaggtggtgaacctgcggatcggctggctgctcacccgtgacgatctcaga
cgggagtgtcaggagcgggacggtgcgggcgagcgctacgcccgcgcgatgtggctgagt
cccgacgactgccggcggctgctcaacgcggccgtgacggcaacccttggcgggtcgccc
ctgaccgcacacggaatctccgccaacgccgaacgcttcctctcgctgtccgagacgatg
cgcgacctcggctatcggccacgagacgacgccgagacggttctgaacgacgaatga

DBGET integrated database retrieval system