KEGG   Nanorana parkeri (Xizang Plateau frog): 108783941
Entry
108783941         CDS       T04897                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
npr  Nanorana parkeri (Xizang Plateau frog)
Pathway
npr00250  Alanine, aspartate and glutamate metabolism
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108783941 (RIMKLA)
Enzymes [BR:npr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     108783941 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     108783941 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp Synapsin_C CPSase_L_D2 Rimk_N
Other DBs
NCBI-GeneID: 108783941
NCBI-ProteinID: XP_018408156
LinkDB
Position
Unknown
AA seq 377 aa
MCSQLWLLTDKNILEDYPQMRILEALRQRCRDQEVDFRLVLMDQIALTVIDGKLGLQIDQ
KTVTSYPQVILVRVPTPTVQSDSDITALRHLEKLGCRLVNRPQAILNCINKFWTFQELAG
HGIPLPDTFSYGGHDEFSKLIDAADPLGYPVVVKNTRGHQGKAVFLARDKHHLLDISHLV
RHDAPYLFQKYVKESHGKDVRVVIVGGQVIGSMLRCSTDGRMQSNCCLGGVGATFPLSEQ
GKVLAMQVSSILGMDICGIDLLLNDNGSFVVCEANANVGFTEFDQACQLDLGGIIADYAI
SLLPSGASKEAPGIPTAPGPPEIAEMQPSASTSSFNGSDGSSCSHGVCDVKEIRDLNHVP
KPCKSALTDGVCDGVTE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgttcccagctctggctactgacagacaaaaatatcctggaggattacccacagatg
cgcatcctggaggcactgaggcagcgatgtcgagaccaagaggtggacttcagactggtg
ttaatggatcagatcgccctcactgtcattgatggcaagctgggcttgcagattgatcag
aagacagtgacctcttatcctcaggttatactggttcgggtcccaactcctaccgtgcag
tcggatagtgatataaccgctctgcgacaccttgagaaactgggctgccgtctagtgaat
cgccctcaagctattctaaattgcataaacaaattctggacgtttcaggagttagctggc
catggaattcctctgcccgatacattctcctatggtggccatgacgaattttcaaaattg
atagatgctgcagatccgcttgggtaccctgtggttgtgaagaacactcgagggcatcaa
ggcaaagcagtgtttctcgcacgggataaacatcacctgctagacatatctcacctggta
cgccatgacgctccatatctgtttcagaagtacgtgaaggaatcacatgggaaagatgtg
cgtgtggtcattgtaggtggacaggtgatcggatccatgctccgctgttctacagatggc
aggatgcagagcaactgctgcttaggcggagtgggtgccaccttccctctcagtgaacaa
ggaaaagtgttagctatgcaagtgtctagcatcctgggaatggatatatgtggcatcgac
cttctcctgaacgacaacggttcctttgtggtctgcgaggctaatgcaaacgtcggtttc
actgaattcgaccaggcctgccagctagatcttggcggcattattgcagattacgcaata
tctctcctccccagcggagcatccaaagaggcgcctgggatccccactgcacccggccct
ccagagatcgccgagatgcaaccaagcgcgtccaccagctcattcaatggcagcgatgga
tcgagctgtagccacggtgtctgtgacgtcaaggaaatcagggatttaaaccacgtgcca
aagccatgcaaatctgcactgacagatggcgtctgtgatggcgtcacagagtaa

DBGET integrated database retrieval system