KEGG   Natronomonas salina: HWV07_07395
Entry
HWV07_07395       CDS       T07280                                 

Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
nsal  Natronomonas salina
Pathway
nsal00630  Glyoxylate and dicarboxylate metabolism
nsal01100  Metabolic pathways
nsal01120  Microbial metabolism in diverse environments
nsal01200  Carbon metabolism
Module
nsal_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nsal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HWV07_07395
Enzymes [BR:nsal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     HWV07_07395
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     HWV07_07395
SSDB
Motif
Pfam: HpcH_HpaI DUF5818 C-C_Bond_Lyase
Other DBs
NCBI-ProteinID: QLD91198
LinkDB
Position
1378874..1380178
AA seq 434 aa
MDKRSHDRKFVRTFFTTPTAEQGEDDSAKKLRSAIELRGMQAPDVWVPDNEDATAPNMRD
EGAENIAEVVAEGGADFPGEIHPRVVWHRDSPETRYRGFQHMLEIADPENGAVENIDGFV
IPEVGDIDDWKKADEFITIVENEYGLEEGSLAMSVIIESGSAELAMEKLREEMGKASNNL
ERLFLLVDGEVDYTKDMRAITPTGGLPEWKELRHNTSRAASAAGLISVDGPYDDIRDVDG
YHERITANNAMGMLGIWSLTPGQVVEANQSPLPPAEGYWIIDADGREVELDDEGDVQVYN
GDRVELEEDGDGYELEVGSDEIYVESEEDLQAELLDLLDYVPSMDDIVDSMEEFEAAKEA
GKGAIAMTQSATVEIDGVQVDVAKDRMWDEATYQALMTPISLFQDVYQNRPDQHDDLAEL
YSEDVVERAMEVGE
NT seq 1305 nt   +upstreamnt  +downstreamnt
atcgacaaacgctcccacgaccggaagttcgtgcggacgttcttcaccacgccgaccgca
gagcagggagaggacgactccgcgaagaagctccgcagcgccatcgagctccgcggcatg
caggcccccgacgtctgggtcccggacaacgaggacgccaccgcgccgaacatgcgcgac
gagggcgccgagaacatcgccgaggtcgtcgccgagggcggcgccgacttccccggcgag
atccacccccgcgtcgtctggcaccgcgacagccccgagacccgctaccgcggcttccag
cacatgctcgagatcgccgaccccgagaacggcgccgtcgagaacatcgacggcttcgtc
atccccgaggtcggcgacatcgacgactggaagaaggccgacgagttcatcaccatcgtc
gagaacgagtacggcctcgaggagggcagcctcgcgatgtccgtcatcatcgagtccggc
tccgccgaactcgccatggagaagctccgcgaggagatgggcaaggcatccaacaacctc
gagcggctcttcctcttggtcgacggcgaggtcgactacacgaaggacatgcgcgccatc
acgccgaccggcggcctccccgagtggaaggagctccgccacaacacctcgcgtgcggcc
agcgcggccggcctgatctccgtggacggcccgtacgacgacatccgtgacgtcgacggc
taccacgagcgcatcaccgccaacaacgcgatgggcatgctcggcatctggtcgctcacc
cccggccaggtcgtcgaggccaaccagagcccgctgccgcccgccgagggctactggatc
atcgacgccgacggccgcgaggtcgaactcgacgacgagggcgacgtccaggtctacaac
ggcgaccgcgtcgagctcgaggaggacggcgacggctacgagctcgaggtcggtagcgac
gagatctacgtcgagagcgaggaggacctccaggcggagctcctcgacctgctcgactac
gtccccagcatggacgacatcgtcgactccatggaggagttcgaggccgccaaggaggcc
ggcaagggcgccatcgcgatgacccagtcggccaccgtcgagatcgacggcgtccaggtc
gacgtcgccaaggaccgcatgtgggacgaggcgacctaccaggccctcatgacgccgatc
tcgctgttccaggacgtctaccagaaccgtcccgaccagcacgacgacctcgcggagctg
tacagcgaggacgtcgtcgagcgcgcgatggaagtcggcgagtaa

DBGET integrated database retrieval system