KEGG   Nicotiana sylvestris (wood tobacco): 104238653
Entry
104238653         CDS       T05026                                 
Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic-like
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
nsy  Nicotiana sylvestris (wood tobacco)
Pathway
nsy00902  Monoterpenoid biosynthesis
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    104238653
Enzymes [BR:nsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     104238653
    4.2.3.16  (4S)-limonene synthase
     104238653
    4.2.3.105  tricyclene synthase
     104238653
    4.2.3.117  (-)-camphene synthase
     104238653
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth DUF6793
Other DBs
NCBI-GeneID: 104238653
NCBI-ProteinID: XP_009791411
UniProt: A0A1U7XP70
LinkDB
Position
Unknown
AA seq 608 aa
MLFTNVGILLPMATSRRPPPNTCFPSFTPGKSSTISCHSKAEPPLNHSTISTNQSSSSDL
NPIRRSGNYEPTTWDFEYIQSIHNDYVGEKYIKRFNKLKKEMKEKMMIMINEGSEELDKL
ELIDNLQRLGVSYHFNDEIMQILRSIYLNASSGDSLYATALKFRLLRQHGFHISQDILND
FKDEQGNLKQSLCKNIKGLLQLYEASFLSTETESTFLECANIFAKSHLQNYLNNQIYDED
DVTVTLVRHALELPLHWMMLRVETRWYINIYEKMPNANPLLLELAKLDFNIVQATHQEDL
RNLSRWWKNSCLAQRLPFTRDRIVEAFLWIAGMMFEPQKNQLCRTLLTRVTAMATVIDDI
YDVYGTLDELELFTRAVERMDLKAIDHLPDYMKVCYLALFNTLTEIAYEVLKEQGINIIP
YLQKSWGDLCKAYLQEARWYYKGYIPTLEEYMDNAWISVGSLVIVFNAFFFVTNPITKEA
LEYLSKYPDIIRWSATIIRLADDLATTSDEMKRGDVAKSIQCYMNEKGVSEEDARKHISS
LINETWKLINTAQRENSIFSEAFIRCGVNIARTGQSIYQYGDGHGIQNSMIENRNSELFF
EPIKISVP
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgttattcaccaacgtagggatactgctacccatggctacctccagaagacctccacct
aatacctgttttccctcttttacccctggaaaatcatcaacaatatcctgccattctaag
gctgaaccaccacttaatcactctactatttccactaatcagtcatcatcttcagatctt
aatcccattaggcgttcagggaattacgaacccaccacgtgggattttgaatatattcag
tccatacacaatgattatgtgggagagaagtatatcaaacggtttaacaaactgaagaag
gaaatgaaggagaagatgatgataatgattaatgagggatcagaagaattagataagttg
gagctaattgataatttacaaaggcttggagtaagttaccacttcaacgatgaaatcatg
caaattttgaggagcatatacctaaatgcatcctcaggagattcattatacgccacagcc
ttgaaatttagactcttgagacaacatggttttcatatctctcaagatatattgaacgat
ttcaaggatgagcagggtaacctcaagcaaagtctctgtaaaaatataaaagggttgtta
caattatatgaagcttcatttctctctaccgaaactgaaagcacttttctagagtgcgcc
aatatatttgcaaaatctcatctacagaattatctgaacaatcaaatatatgatgaagac
gatgtgacagtcacactagtgcgccatgccctggaacttcctttgcattggatgatgttg
agagttgagacaaggtggtatataaacatttatgagaaaatgccaaatgctaatcctctt
ctgctggaacttgctaagttggacttcaacattgttcaagcaacacaccaagaagattta
agaaatctatcaaggtggtggaagaactcatgccttgcacaaagattgccatttacgagg
gatagaattgttgaagctttcttatggatagcggggatgatgtttgaacctcaaaagaac
cagctctgccgaacactgttgacaagggtcactgctatggctacagttatagatgatatt
tatgatgtctatggcactcttgatgagttggaactcttcactcgtgctgttgaaagaatg
gacctaaaagcgattgaccatcttccagactatatgaaagtatgttaccttgcactcttc
aacactctcactgaaattgcctatgaagtactcaaagagcaagggatcaacatcataccc
taccttcaaaaatcatggggagatttgtgcaaagcttacttacaagaagcaagatggtac
tacaaagggtatataccaactctggaagaatacatggataatgcatggatttcagttgga
agtcttgttatagtattcaatgcattcttctttgtcaccaatccaattaccaaagaggcg
ctggaatacttaagcaagtaccctgacattattcgttggtctgctacaattattcgtctt
gctgatgatttagcgacaacatctgatgaaatgaaaagaggtgatgttgccaagtcaatt
caatgttacatgaatgagaagggtgtttccgaagaagatgcaagaaaacacatcagttct
ttgataaatgaaacatggaaactgatcaacacggctcaacgggaaaattcaatattttct
gaagcattcattagatgtggggtaaatattgcaagaacgggacagagcatttaccagtat
ggagatgggcatggaattcaaaattctatgattgaaaatcgcaattccgaattatttttt
gagcccatcaaaatttcagttccataa

DBGET integrated database retrieval system