KEGG   Neurospora tetrasperma: NEUTE1DRAFT117740
Entry
NEUTE1DRAFT117740 CDS       T03451                                 
Symbol
NEUTE1DRAFT_117740
Name
(RefSeq) cytochrome P450 55A2
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
nte  Neurospora tetrasperma
Pathway
nte00910  Nitrogen metabolism
nte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NEUTE1DRAFT117740 (NEUTE1DRAFT_117740)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nte00199]
    NEUTE1DRAFT117740 (NEUTE1DRAFT_117740)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     NEUTE1DRAFT117740 (NEUTE1DRAFT_117740)
Cytochrome P450 [BR:nte00199]
 Cytochrome P450, fungi type
  CYP55 family
   NEUTE1DRAFT117740 (NEUTE1DRAFT_117740)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 20823376
NCBI-ProteinID: XP_009853211
JGI: Neute_matA2_117740
UniProt: F8MTP0
LinkDB
Position
Unknown
AA seq 404 aa
MGALTENLEFPFRRASGLDPPPEYAWLRKTDPVTQVRLFDGSLAWLVTKYHDVCQVATDE
RLSKERTRPGFPELAAGGKEAAKNRATFVDMDPPKHMQYRGMVQPIFEMEHVKELEPYIQ
KTVDDLLERMKNMGCEGGPVDLVQNFALPVPSYIIYTILGVPVEDLEFLTQQNSIRTNGS
STAREASAANQELLNYLRRLAEQRLQEPEDDLLSKLMTEQVKTGKLDTADAVQMAFLLLV
AGNATMVNMIALGIVTLFLNPSQLEELKRDPSVVPAFVEELSRFHTASAMAIRRVAKEDL
EIRGKTIKKGEGVIASNLSANRDEEVFKDADKFDMHREWPVKELGFGWGEHRCIAEFLAK
AELKAVFETIFKKLPDLKIAVPFDEIEYTPLDRDVGIVKLPVTW
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgggtgcgctcaccgaaaacctcgagttccccttccgccgtgcttccggcctcgacccg
cctcccgagtacgcctggctccgcaagaccgacccggtgacccaggtccgcctcttcgac
ggcagcctcgcctggctggtgaccaagtaccacgacgtctgccaggtggccacagatgag
cggctgtccaaggagcgcacgaggcccggcttccccgagctcgccgcgggagggaaagag
gcggccaagaatcgggccacgtttgtggacatggatccgcccaagcacatgcagtatcgc
ggcatggttcagccgatttttgaaatggaacatgtcaaggagctggaaccgtacatccag
aagacggtggatgacttgttggagaggatgaagaatatggggtgcgagggcggtccggtg
gatctggtgcagaatttcgcgctgccggtgccttcttatatcatatataccatcctcggc
gttccggttgaggacctcgagtttttgactcagcagaactccatccgtacgaacggaagt
tcgacagcgcgagaggcatctgctgctaatcaggaactcctcaactacctccgccgtctc
gccgaacagcgtctgcaggagcccgaggatgacttgctcagcaagcttatgaccgagcaa
gtcaagaccggcaagctcgacacagccgatgccgtccagatggctttcctcttgctagtg
gctggtaatgccaccatggttaacatgattgccttgggcatcgtgaccctcttcctaaac
ccttcccaactcgaagaactcaagcgcgacccctctgtagtccctgcctttgtcgaagaa
ctaagccgattccacaccgcttcggccatggccatccgccgcgttgccaaggaggacctg
gagatccgcggcaagaccatcaagaaaggcgagggcgtcattgcctccaacttgtcggcc
aaccgcgacgaggaggtgttcaaggatgcggacaagttcgacatgcatcgcgagtggcct
gtgaaagagctcgggtttgggtggggagaacataggtgcatcgcggagtttttggcgaag
gcggagctgaaggctgtttttgaaactattttcaagaagttgccggatctgaagattgcg
gtgccttttgacgagattgaatacacgccgcttgaccgcgatgttggcattgttaagctg
cctgttacttggtaa

DBGET integrated database retrieval system