KEGG   Nicotiana tomentosiformis: 104090536
Entry
104090536         CDS       T05025                                 
Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic-like
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00902  Monoterpenoid biosynthesis
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    104090536
Enzymes [BR:nto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     104090536
    4.2.3.16  (4S)-limonene synthase
     104090536
    4.2.3.105  tricyclene synthase
     104090536
    4.2.3.117  (-)-camphene synthase
     104090536
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth DUF6793 SapC
Other DBs
NCBI-GeneID: 104090536
NCBI-ProteinID: XP_009593950
LinkDB
Position
Unknown
AA seq 608 aa
MLFTNVGILLPMANYRRPPPNTCFPSFTPGKSSTISCLSKAEPPLNHSTISTNQSSFSDL
NPIRRSGNYEPTTWDSEYIQSIHNDYVGEKYIKRFNKLKKEMKEKMMIMINEGSEELDKL
ELIDNLQRLGVSYHFNDEIMQILSSIHLNASTGDSLYATALKFRLLRQHGFHVSQDILND
FKDEHGHLKESLCVDTERLLQLYEASFLSTETESTFLECANIFAMSQLQNFLNNQLYEED
NVTVALVRHALELPLHWMMLRVETKWYINIYERMSNANALLLELAKLDFNIVQATHQEDL
RNLSRWWKNSCLAEKLPFTRDRIVEAFLWIAGMMFEPQKNQLCRTLLTRVTAMATVIDDI
YDVYGTLDELELFTCAVERMELKAIDHLPDYMKVCYLALFNTVTEIAYEVLKEQGINIIP
YLQKPWGDLCKAYLQEARWYYEGYIPTLEEYMDNAWITVGSLVIVFNAFFFVTNPITKEA
LKYLSKYPDIIRWSATIIRLADDLATTSDEMKRGDVAKSIQCYMNEKGVSEEDAKKHISS
LIKETWKLINTAQRENSIFSEAFIRCAVNIARTGQSIYQYGDGHGIQNYMIKNRNSELFF
EPIRISIP
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgttattcaccaacgtagggatactactgcccatggctaactacagaagacctccacct
aatacctgttttccctcttttacccctggaaaatcatcaacaatatcctgcctttctaaa
gctgaaccaccacttaatcactctactatttccactaatcagtcatcattttcagatctt
aatcccattaggcgttcagggaattacgaacctaccacatgggattctgaatatattcag
tccatacacaatgattatgtgggagagaagtatatcaaacggtttaacaaactgaagaag
gaaatgaaggagaagatgatgataatgattaatgagggatcagaagaattagataagttg
gagctaattgataatttacaaaggcttggagtaagttaccacttcaacgatgaaatcatg
caaattttgagtagcatacaccttaatgcatccacaggagattcattatacgccacagct
ctgaaatttagactcttgagacaacatggttttcatgtctctcaagatatattgaacgat
ttcaaggatgagcatggtcacctcaaagagagtctctgtgtagatacagaaagattgtta
caattatatgaagcttcatttctctctaccgaaactgaaagcacttttctagagtgcgcc
aatatatttgcaatgtcacagctacagaattttctgaacaatcaattatatgaggaagac
aatgtgacagtcgcattagtgcgccatgccctggaacttcctttgcattggatgatgttg
agagttgagacaaagtggtacataaacatttatgagagaatgtcgaatgctaatgctctt
ctgctcgagcttgctaagttagacttcaacattgttcaagcaacacaccaagaagattta
agaaatctatcaaggtggtggaagaactcatgccttgcagaaaaattgccatttacaagg
gatagaatagttgaagctttcttatggatagcggggatgatgtttgaacctcaaaagaac
cagctgtgccgaacactgttgacgagggtcactgctatggctacagttatagatgatatt
tatgatgtctatggcactcttgatgagttggaacttttcacttgtgctgttgaaagaatg
gagctaaaagcgattgaccatcttccagactatatgaaagtatgctaccttgcactcttc
aacactgtcactgaaattgcatatgaagttctcaaagagcaaggaatcaacatcataccc
taccttcaaaaaccatggggagatttgtgcaaagcttacttacaagaagcaagatggtac
tacgaagggtatataccaactctggaagaatacatggataatgcatggattacagttgga
agtcttgttatagtattcaatgcattcttctttgttacgaatccaattaccaaagaggcg
ctgaaatatttaagcaagtaccctgacattattcgttggtctgctacaattattcgtctt
gccgatgatttagcgacaacatcggatgaaatgaaaagaggagatgttgccaagtcaatt
caatgttacatgaatgagaagggtgtttctgaagaagatgcaaaaaaacacatcagttct
ttgataaaagaaacatggaaactgatcaacacggctcaacgggaaaattcaatattttct
gaagcattcattagatgtgcagtaaatattgcaagaacgggacagagcatttaccagtat
ggagatgggcatggaattcaaaattatatgattaaaaatcgcaattccgaattatttttt
gagcccatcagaatttcaattccataa

DBGET integrated database retrieval system