KEGG   Nocardia terpenica: CRH09_26850
Entry
CRH09_26850       CDS       T05168                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
ntp  Nocardia terpenica
Pathway
ntp00333  Prodigiosin biosynthesis
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CRH09_26850
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: ATL69256
UniProt: A0A291RNW6
LinkDB
Position
6089207..6090340
AA seq 377 aa
MGCPFEQALTTALEIAVTSPSSHNCQPWAVARLTSGPARRRAAAAGPSAAGDDVATPHEF
LVLASEQNRELRALPAHRAEMRISCGLFWHLLRRALAAQGWTAEPAPMPTAAELREVGLP
PTWTPLRLARFRRSGEVPESLDGLRTLARRRQTNRGPYSDRPVTEAVLNELAGRRAGAEP
RIHIRHLRSDDERKRFARFVARYGGRDFAHRDAWRETHSYIRHTESEAAASGDGFALTHL
FGPLSPAQRRLRRVVLAPPIMAALRATGFPRVLSGQLAAVVRRSPVIVSMSLPDADGTDS
DMIAAGEVLSEYWLRATGLGLVLHPISVVVQHGDLRRKLQAEFDLPGGVFFIARLGYPTM
RFPPSPRHAATASLRAL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggggtgtcccttcgagcaggccctgacgacggccctggagatcgcggtgacgagtccg
tcgtcgcacaactgccagccgtgggcagtggcccgattgacgagcggccccgcgcgccgt
cgggcggcggcggccggtccgtctgcggcaggcgacgacgtggcgaccccgcacgaattc
ctggtcctggcgtccgagcagaatcgcgagctgcgcgccttgcccgcgcatcgcgccgag
atgcgaatcagctgcgggctgttctggcatctgctccggcgagcgctggcggcgcaggga
tggacggccgagcccgccccgatgccgacggcggcggaactgcgggaggtcggcctcccg
cccacctggacccccttgcgactggcgcggtttcgccggagcggcgaggtgcccgaatct
ctcgacgggctgcggactctcgcacgacgacggcagaccaacaggggtccctacagcgac
aggccggtgacggaggccgtcctgaacgaactcgccgggcgccgtgcgggcgccgaaccc
cgaatccacatccgccatctgcgatccgatgacgagcgaaagcggttcgcccgcttcgtc
gcccgctacggcggacgggacttcgcgcaccgggacgcctggcgggagacgcattcgtac
atccggcacaccgagtccgaggccgccgcctcgggcgacggtttcgctctcacccatctg
ttcgggccactgtcgcccgcacagcggcggctcaggcgcgtcgtgctcgcaccgcccatc
atggcggcactgcgcgcgacagggttcccgcgagtcctttccgggcagctcgccgccgtc
gtgcggcgctcaccggtcatcgtgtccatgagcctgccggatgcggacggcacggactcg
gacatgatcgcggcgggcgaggtgctgtccgaatactggctgcgggcaaccggtctcggg
ttggtcctgcacccgatcagtgtcgttgtccagcacggcgatctgcgccgaaaactgcag
gccgagttcgatctgccagggggcgtcttcttcattgcccggctgggctatccgacgatg
cgattcccgccctcaccccgccacgccgcgaccgcgtccctgcgtgcgctgtga

DBGET integrated database retrieval system