KEGG   Nocardia terpenica: CRH09_26880
Entry
CRH09_26880       CDS       T05168                                 
Name
(GenBank) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
ntp  Nocardia terpenica
Pathway
ntp00333  Prodigiosin biosynthesis
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CRH09_26880
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: ATL69262
UniProt: A0A291RQ05
LinkDB
Position
complement(6097494..6100157)
AA seq 887 aa
MTTSNRATRDLVAVLGGPDRVPPETLGGKGARLDEMIRAGLPVPPAFCLTTGLFERFLRD
VGLDAGALGEEPSRIRAAILAAEVPEEIAAAVLDAYAGLGRPRVAVRSSASREDSASQSF
AGQHDTVLDIAGDAALLDAVKTCWASLWSERAVAYRACGGAGTIAVVVQRMIPADAAGVL
FTRDPISGRTDRLVVDACWGLGEGLVAGKVTADSFVVDPAGPEVIEQNVRYKVTRCASVR
PGVVELVKVDEANRSTPCLTAGQLGDLAALALRVRELYGAEQDIEWALLDGAPHLLQARP
ITAAPMPPPRRSPYGRPQPEPIRQGTMWSRMDIGEIFTGAMTPLGLSFARYYQHHVHGDC
IRAVGVRDTCDMSEQMGHFQGYVYLNISYTAYVLSQALPMRDQRDFTERFASEEIDLTDY
RNPFGGYRMGIPGLLSTAFWTRTAVAELRDMAKRTDRMVEARLYEFDRAQRLNLRTFDRR
ELRDEMRRRLDHFHDMHVGYMPYFMNAFGFYGVLQQMCAAWLDEAGDRFVNRLKTDMSNL
RTVESAREVWELAQAARQQPRVLEIIRSGSPHEVAARLRSDAAGQAFWQAQMEPFLRENG
VRAHQEMELTHPRWIDDPAYVFQMIRRYSEEGFSIGHILESRPDPGDDEAVAAMRKLPWP
KRRAMAGVISLYEKCSTLRETARVSMIGSIWLVRQVVYEVARRLIGAGVLRSFDEVAYLD
FADVLRYLDSDEDPRDIVSRAELEKAHRTARNYARLPAPPLSFLGEWDVTQSIRPFPDGA
RLEGLGTSPGRAVGRARIVENLAWQADEFHAGEILVTRYTDSSWTPLFAIASGIVTDIGS
MLSHSSIVSREFRVPAVVNTKHATQAIKTGDLIMVDGDRGVVEVVEG
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgaccacctcgaatcgggcgacgcgagatctcgtcgccgttctcggcggaccggaccgg
gttccgccggagacgttgggcggcaaaggcgcccggctcgacgagatgattcgcgccgga
ctgccggtgcccccggccttctgcctcacgaccgggctgttcgagcgtttcctgcgggac
gtcggtctggatgccggggccctcggcgaggagccctcccggatccgggcggcgatcctg
gccgccgaggttcccgaggagatcgccgctgcggtcctcgatgcctatgcggggctgggg
cggccgcgcgtcgcggtgagatcgtcggcgagcagggaggattcggcctcccagtccttc
gccgggcagcacgacaccgtgctcgacatcgccggtgatgccgcgctgctcgacgccgtc
aagacatgctgggcatcgctgtggtcggagcgggccgtcgcctaccgggcctgcggcggc
gccggcacgatcgccgtcgtggtccagcgcatgatcccggcggatgccgccggtgtgctg
ttcacccgcgatccgatcagcggccgcaccgaccgcctcgtggtcgacgcctgctgggga
ctcggcgagggactggtcgcgggaaaggtcaccgccgattcgttcgtcgtggaccctgcc
ggtcccgaggtgatcgagcagaacgtgcggtacaaggtcacccgctgcgcctcggttcga
ccgggtgtggtggaactggtcaaggtggacgaggcgaaccgcagcacgccctgtctgacc
gccgggcaactgggcgatctcgccgcgctggcactgcgggtgcgcgagctctacggcgcc
gaacaggacatcgagtgggcgctgctcgacggtgcaccgcacctgctgcaggcccgcccc
atcaccgccgctccgatgccgcccccgcggcgcagtccctacggccgaccgcagcccgag
ccgattcggcagggcaccatgtggtcccgcatggacatcggggagatcttcaccggcgcc
atgacgccgctgggcctgtcgttcgcccggtactaccagcaccatgtgcacggcgattgc
atccgggccgtcggcgtccgcgacacctgcgatatgtccgagcagatggggcacttccag
ggctacgtctatctgaatatctcctataccgcctacgtgctgagccaggccctgccgatg
cgggaccagcgcgacttcaccgagcgcttcgccagcgaggaaatagatctgaccgactac
cgaaatcccttcggcggctaccgcatgggcattcccggactgttgtccacggcgttctgg
acgcggaccgccgtggccgagctacgggatatggcgaagcggaccgatcggatggtcgag
gcgcggttgtacgaattcgaccgcgcccagcgcctgaacctgcgcacgttcgaccgccgc
gaactccgcgacgagatgcggcgacggctggaccacttccacgatatgcatgtcggctac
atgccgtacttcatgaacgccttcgggttctacggtgtgctgcaacagatgtgcgccgcc
tggctcgacgaggcgggcgaccggttcgtgaaccgcctcaagaccgatatgtccaacctg
cggaccgtcgagtcggcccgcgaggtatgggagctggcgcaggccgcccggcagcagccc
cgggtgctggagatcattcgttccggctcgccccacgaggtggccgcccggctgcgatcc
gatgcggccgggcaggcgttctggcaggcgcagatggaaccgttcctgcgcgagaacggc
gttcgtgcccatcaggagatggagctgacccatccgcggtggatcgatgatcccgcctat
gtgttccagatgattcgccgctactccgaggagggcttctccatcggccacatcctcgaa
tccaggcccgatcccggcgacgacgaggcggtggcggcgatgcgaaaactgccgtggccc
aagcgccgtgccatggcgggcgtgatctcgctgtacgagaagtgcagcacgctgcgcgaa
accgcccgggtgtcgatgatcggatccatctggctggtccgccaggtcgtctacgaggtg
gcccgccgcctgatcggggccggtgtgctgcggtccttcgacgaggtcgcctacctggac
ttcgccgatgtgctgcgctatctcgacagcgacgaggatccgcgtgacatcgtctcccgc
gccgagctggagaaggcgcaccggaccgcccgcaactacgcccggctgcccgcaccgccg
ctcagtttcctcggcgaatgggatgtgacccaatcgattcggcccttcccggacggcgcc
cggctcgaggggctgggcaccagcccgggccgcgcggtcggccgcgcccgcattgtcgag
aatctggcctggcaggccgacgaattccacgcgggcgagattctggtgacccggtacacc
gattcctcgtggactccgctgttcgccatcgcgtccggcatcgtcaccgatatcggctcg
atgctgtcgcacagctcgatcgtgtcgcgggaattccgtgtcccggccgtcgtcaacacc
aaacacgccacccaggccatcaagaccggcgacctgatcatggtcgacggcgaccggggt
gtggtcgaggtggtcgagggatga

DBGET integrated database retrieval system