Neogale vison (American mink): 122891793 Help Entry 122891793         CDS       T08764                                  Symbol CALML3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism nvs  Neogale vison (American mink) Pathway nvs04014   Ras signaling pathway nvs04015   Rap1 signaling pathway nvs04020   Calcium signaling pathway nvs04022   cGMP-PKG signaling pathway nvs04024   cAMP signaling pathway nvs04070   Phosphatidylinositol signaling system nvs04114   Oocyte meiosis nvs04218   Cellular senescence nvs04261   Adrenergic signaling in cardiomyocytes nvs04270   Vascular smooth muscle contraction nvs04371   Apelin signaling pathway nvs04625   C-type lectin receptor signaling pathway nvs04713   Circadian entrainment nvs04720   Long-term potentiation nvs04722   Neurotrophin signaling pathway nvs04728   Dopaminergic synapse nvs04740   Olfactory transduction nvs04744   Phototransduction nvs04750   Inflammatory mediator regulation of TRP channels nvs04910   Insulin signaling pathway nvs04912   GnRH signaling pathway nvs04915   Estrogen signaling pathway nvs04916   Melanogenesis nvs04921   Oxytocin signaling pathway nvs04922   Glucagon signaling pathway nvs04924   Renin secretion nvs04925   Aldosterone synthesis and secretion nvs04970   Salivary secretion nvs04971   Gastric acid secretion nvs05010   Alzheimer disease nvs05012   Parkinson disease nvs05022   Pathways of neurodegeneration - multiple diseases nvs05031   Amphetamine addiction nvs05034   Alcoholism nvs05133   Pertussis nvs05152   Tuberculosis nvs05163   Human cytomegalovirus infection nvs05167   Kaposi sarcoma-associated herpesvirus infection nvs05170   Human immunodeficiency virus 1 infection nvs05200   Pathways in cancer nvs05214   Glioma nvs05417   Lipid and atherosclerosis nvs05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122891793 (CALML3)    04015 Rap1 signaling pathway     122891793 (CALML3)    04371 Apelin signaling pathway     122891793 (CALML3)    04020 Calcium signaling pathway     122891793 (CALML3)    04070 Phosphatidylinositol signaling system     122891793 (CALML3)    04024 cAMP signaling pathway     122891793 (CALML3)    04022 cGMP-PKG signaling pathway     122891793 (CALML3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122891793 (CALML3)    04218 Cellular senescence     122891793 (CALML3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122891793 (CALML3)   09152 Endocrine system    04910 Insulin signaling pathway     122891793 (CALML3)    04922 Glucagon signaling pathway     122891793 (CALML3)    04912 GnRH signaling pathway     122891793 (CALML3)    04915 Estrogen signaling pathway     122891793 (CALML3)    04921 Oxytocin signaling pathway     122891793 (CALML3)    04916 Melanogenesis     122891793 (CALML3)    04924 Renin secretion     122891793 (CALML3)    04925 Aldosterone synthesis and secretion     122891793 (CALML3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122891793 (CALML3)    04270 Vascular smooth muscle contraction     122891793 (CALML3)   09154 Digestive system    04970 Salivary secretion     122891793 (CALML3)    04971 Gastric acid secretion     122891793 (CALML3)   09156 Nervous system    04728 Dopaminergic synapse     122891793 (CALML3)    04720 Long-term potentiation     122891793 (CALML3)    04722 Neurotrophin signaling pathway     122891793 (CALML3)   09157 Sensory system    04744 Phototransduction     122891793 (CALML3)    04740 Olfactory transduction     122891793 (CALML3)    04750 Inflammatory mediator regulation of TRP channels     122891793 (CALML3)   09159 Environmental adaptation    04713 Circadian entrainment     122891793 (CALML3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122891793 (CALML3)   09162 Cancer: specific types    05214 Glioma     122891793 (CALML3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122891793 (CALML3)    05163 Human cytomegalovirus infection     122891793 (CALML3)    05167 Kaposi sarcoma-associated herpesvirus infection     122891793 (CALML3)   09171 Infectious disease: bacterial    05133 Pertussis     122891793 (CALML3)    05152 Tuberculosis     122891793 (CALML3)   09164 Neurodegenerative disease    05010 Alzheimer disease     122891793 (CALML3)    05012 Parkinson disease     122891793 (CALML3)    05022 Pathways of neurodegeneration - multiple diseases     122891793 (CALML3)   09165 Substance dependence    05031 Amphetamine addiction     122891793 (CALML3)    05034 Alcoholism     122891793 (CALML3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122891793 (CALML3)    05418 Fluid shear stress and atherosclerosis     122891793 (CALML3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:nvs01009]     122891793 (CALML3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nvs04131]     122891793 (CALML3)    03036 Chromosome and associated proteins [BR:nvs03036]     122891793 (CALML3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nvs04147]     122891793 (CALML3) Protein phosphatases and associated proteins [BR:nvs01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122891793 (CALML3) Membrane trafficking [BR:nvs04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122891793 (CALML3) Chromosome and associated proteins [BR:nvs03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122891793 (CALML3) Exosome [BR:nvs04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122891793 (CALML3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Dockerin_1 EF-hand_EFHB_C Temptin_C EF-hand_11 Caleosin EF-hand_STIM1 EFhand_Ca_insen Fe_hyd_lg_C SurA_N_3 DUF5580_M DUF1103 Motif Other DBs NCBI-GeneID:  122891793 NCBI-ProteinID:  XP_044083667 LinkDB All DBs Position 12:complement(143643221..143644428) Genome browser AA seq 149 aa AA seqDB search MADQLSEEQVAEFKEAFCLFDRDGDGVITTQELGTVMRSLGQNPTEAELRDMVSEIDRDG NGTVDFPEFLGVMARQLKGRDSEDQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt gacagggacggggacggcgtcatcaccacccaggagctgggcaccgtcatgcgctccctg ggccagaaccccacggaggccgagctgcgcgacatggtaagcgagatcgaccgcgacggc aacggcaccgtggacttccccgagttcctgggcgtgatggccaggcagctgaagggcagg gacagcgaggaccagatccgcgaggccttccgcgtcttcgacaaggacggcaacggcctg gtgagcgccgctgagctgcggcacgtgatgaccaggctgggggagaagctgagcgacgag gaggtggacgagatgatccgggccgcggacgtggacggggacgggcaggtgaactacgag gagttcgtccacatgctggtctccaagtga

DBGET integrated database retrieval system