Neogale vison (American mink): 122907678 Help Entry 122907678         CDS       T08764                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism nvs  Neogale vison (American mink) Pathway nvs04060   Cytokine-cytokine receptor interaction nvs04061   Viral protein interaction with cytokine and cytokine receptor nvs04062   Chemokine signaling pathway nvs04620   Toll-like receptor signaling pathway nvs04621   NOD-like receptor signaling pathway nvs04623   Cytosolic DNA-sensing pathway nvs04668   TNF signaling pathway nvs05020   Prion disease nvs05142   Chagas disease nvs05163   Human cytomegalovirus infection nvs05164   Influenza A nvs05168   Herpes simplex virus 1 infection nvs05323   Rheumatoid arthritis nvs05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:nvs00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     122907678 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122907678 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     122907678 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122907678 (CCL5)    04621 NOD-like receptor signaling pathway     122907678 (CCL5)    04623 Cytosolic DNA-sensing pathway     122907678 (CCL5)    04062 Chemokine signaling pathway     122907678 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     122907678 (CCL5)    05168 Herpes simplex virus 1 infection     122907678 (CCL5)    05163 Human cytomegalovirus infection     122907678 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     122907678 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     122907678 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     122907678 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122907678 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nvs04052]     122907678 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:nvs00536]     122907678 (CCL5) Cytokines and neuropeptides [BR:nvs04052]  Cytokines   Chemokines    122907678 (CCL5) Glycosaminoglycan binding proteins [BR:nvs00536]  Heparan sulfate / Heparin   Chemokines    122907678 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  122907678 NCBI-ProteinID:  XP_044106427 UniProt:  U6CQE1 LinkDB All DBs Position 5:complement(33599659..33606010) Genome browser AA seq 91 aa AA seqDB search MKVSAATFAVLLATAAFCAPASASPYASDTTPCCFAYISRRLPFTHIQEYFYTSSKCSMP AVVFVTRKHRQVCANPQKKWVRDHINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagctacctttgcagtcctcctagccaccgccgccttctgcgctcct gcctctgcctccccatatgcctcggacaccaccccctgctgctttgcctacatctcccgc cgactgcccttcacccacatccaggagtatttctacaccagcagcaagtgctccatgcca gccgtcgtctttgtcacccggaagcaccgccaagtgtgtgccaacccacagaagaaatgg gtgcgcgaccacatcaactctttggagatgagttag

DBGET integrated database retrieval system