KEGG   Ornithorhynchus anatinus (platypus): 100073839
Entry
100073839         CDS       T01045                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00250  Alanine, aspartate and glutamate metabolism
oaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100073839 (RIMKLA)
Enzymes [BR:oaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100073839 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100073839 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATP-grasp Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 100073839
NCBI-ProteinID: XP_028921643
Ensembl: ENSOANG00000009723
LinkDB
Position
5:80191600..80242790
AA seq 385 aa
MCSRLWFLTDRRIGEDYPQLQILRALRQRCAEQNVQFRALLMDQLAVTVVGGHLGLQVNR
EALTTFPDVVLVRVATPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHDDFAKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDAPYLFQKYVKESHGRDIRVVVVGGRVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFVAFDQACNLDVGGIIADYTM
SLLPGRLSRKLSLLSEGPGPGETGEAEGSAAAQAVPESAYATNGGSTSSESDPELGEVRA
AAARPVRLPALPDPSYNINNMVASE
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtgctcccgcctgtggttcctgacggaccggcggatcggcgaggattacccgcagctg
cagatcctccgcgctctccgacaacgctgcgccgagcagaacgtgcagttcagggccctg
ctcatggaccagctggccgtcaccgtggtcggcggacacctcgggctgcaggtgaaccgg
gaggctctgacgacgttcccggacgtcgtgctggtgcgcgtggccacgccctcggtgcag
tccgacagcgacatcaccgtgctgaggcacttggagaagttaggctgccgcttggtcaac
cggccgcagagcatcttgaactgcatcaacaagttctggacgttccaggagctagccggg
catggagtccctatgccagacaccttctcctacggtggtcacgatgacttcgcaaaaatg
atcgatgaagccgagcccctgggttaccctgtggtggtgaagagcacgcgaggacaccgc
ggaaaagccgttttccttgcgagagataagcaccatctatccgacatctgccatctgatc
cgccacgatgcaccctacctgttccagaagtacgtgaaggaatcccacggacgagacatc
cgggtggtggtggtgggaggccgcgtgattgggtccatgctccgctgctctaccgacggg
aggatgcaaagcaactgctctttagggggcgtaggcgtcatgtgtccactcaccgagcaa
ggcaagcagttagccattcaggtctccaacatcttgggcatggacttctgcggcatcgat
ctcctcatcatggacgacggctccttcgtcgtgtgcgaggccaacgccaacgtaggtttc
gtcgccttcgaccaggcgtgcaatttagacgtcggggggatcatcgcagattacaccatg
tccctgcttcccggcaggctgtccagaaagctgagcctcctctccgaggggcccggcccg
ggggagaccggggaggccgaggggtcggcggcggcccaggccgtccccgagagcgcctat
gccaccaacgggggatcgacctccagcgagagcgaccccgagctgggagaggtcagagcc
gccgccgccaggcccgtccggctcccggcgctgccggaccccagctataacattaacaac
atggtggcctccgaatga

DBGET integrated database retrieval system