KEGG   Ornithorhynchus anatinus (platypus): 100084666
Entry
100084666         CDS       T01045                                 
Name
(RefSeq) integrin alpha-X-like
  KO
K06462  integrin alpha X
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04610  Complement and coagulation cascades
oaa04810  Regulation of actin cytoskeleton
oaa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100084666
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100084666
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100084666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oaa04515]
    100084666
   04090 CD molecules [BR:oaa04090]
    100084666
Cell adhesion molecules [BR:oaa04515]
 Integrins
  Integrin alpha subunits
   100084666
CD molecules [BR:oaa04090]
 Proteins
  100084666
SSDB
Other DBs
NCBI-GeneID: 100084666
NCBI-ProteinID: XP_028913557
LinkDB
Position
2:complement(25871263..25872826)
AA seq 85 aa
MDGPDEAEAAVGAEFGRLMFDTGRYAQFPGQEGFLTAQAKTVVERYEVYNTLPSSWAAPW
GGWCCWPSSLLACTSLDSSSGSTRT
NT seq 258 nt   +upstreamnt  +downstreamnt
atggatgggccagacgaagcagaagcggctgtcggtgctgagttcggccggctgatgttt
gacacggggcggtacgctcagtttcctgggcaggagggattcctgacagctcaggcgaag
accgtggtggagcgttacgaggtttacaacaccctcccctcatcgtgggcagctccgtgg
gggggctggtgctgctggccctcctcactgctggcctgtacaagcttggattcttcaagc
ggcagtacaaggacctga

DBGET integrated database retrieval system