Ornithorhynchus anatinus (platypus): 114815531 Help Entry 114815531         CDS       T01045                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa01521   EGFR tyrosine kinase inhibitor resistance oaa04010   MAPK signaling pathway oaa04014   Ras signaling pathway oaa04015   Rap1 signaling pathway oaa04020   Calcium signaling pathway oaa04151   PI3K-Akt signaling pathway oaa04550   Signaling pathways regulating pluripotency of stem cells oaa04810   Regulation of actin cytoskeleton oaa05167   Kaposi sarcoma-associated herpesvirus infection oaa05200   Pathways in cancer oaa05205   Proteoglycans in cancer oaa05207   Chemical carcinogenesis - receptor activation oaa05218   Melanoma oaa05224   Breast cancer oaa05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114815531 (FGF2)    04014 Ras signaling pathway     114815531 (FGF2)    04015 Rap1 signaling pathway     114815531 (FGF2)    04020 Calcium signaling pathway     114815531 (FGF2)    04151 PI3K-Akt signaling pathway     114815531 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     114815531 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114815531 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114815531 (FGF2)    05205 Proteoglycans in cancer     114815531 (FGF2)    05207 Chemical carcinogenesis - receptor activation     114815531 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     114815531 (FGF2)    05218 Melanoma     114815531 (FGF2)    05224 Breast cancer     114815531 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     114815531 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     114815531 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oaa04052]     114815531 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:oaa00536]     114815531 (FGF2) Cytokines and neuropeptides [BR:oaa04052]  Cytokines   Growth factors (RTK binding)    114815531 (FGF2) Glycosaminoglycan binding proteins [BR:oaa00536]  Heparan sulfate / Heparin   Growth factors/receptors    114815531 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF IL1 Fascin Motif Other DBs NCBI-GeneID:  114815531 NCBI-ProteinID:  XP_028932586 Ensembl:  ENSOANG00000048457 LinkDB All DBs Position 12:54094127..54142785 Genome browser AA seq 158 aa AA seqDB search MAAGAITTLPDAASAAAAAASGPFAPGSFKEPKRLYCKNGGFFLRIQPDGRVDGVREKSD PHIKLQLQAEERGVVSIKGVGANRYLAMNEDGRLSALKWATEECFFFERLESNNYNTYQS RKHSNWYVALKRTGQCKLGPQTRPGQKAILFLPMSAKS NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atggccgccggggccatcaccaccctgcccgacgccgcctccgccgccgccgccgccgcc tccgggcccttcgccccgggcagcttcaaggagcccaagcgcctctactgcaagaacggg ggcttcttcctgcgcatccaacccgacggcagagtcgacggcgtccgggagaagagcgac ccgcacatcaaactacaacttcaggcagaggagagaggagtggtgtctatcaagggcgtg ggtgcgaaccgctatctcgctatgaatgaagacggcaggttgtcggctttgaaatgggca actgaagaatgtttcttttttgaacgcttggaatccaacaactacaacacataccagtca cggaaacattccaattggtacgtggcactgaaacgaactggacagtgtaagctcggcccc caaacgagaccaggacagaaagccatccttttcctcccgatgtccgccaagagctga

DBGET integrated database retrieval system