KEGG   Ornithorhynchus anatinus (platypus): 114817959
Entry
114817959         CDS       T01045                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04927  Cortisol synthesis and secretion
oaa04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    114817959
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114817959
SSDB
Motif
Pfam: MRAP FtsH_ext FixQ
Other DBs
NCBI-GeneID: 114817959
NCBI-ProteinID: XP_039770355
LinkDB
Position
17:17371375..17376600
AA seq 150 aa
MDGEMNSSSSYIFYEYYLDYVDPVPVDERKLGANKYSIVIVFWVSLAAFVVLLFLILLYM
SWSGSARLKNSGSRPECPWSRLLNQPVRRRRCCPTGRAGPSPDGSRVRGSEESGWNCERP
PAEGDGRAPAVSAPPSPPSRPAACGESLLV
NT seq 453 nt   +upstreamnt  +downstreamnt
atggacggcgagatgaactcttccagctcctacattttctacgaatactacctggactat
gtggatccggtgcccgtggacgagaggaagctcggtgccaacaaatactccatcgtcatc
gtcttctgggtgagcctggcggccttcgtggtgcttctcttcctcatcctgctctacatg
tcctggtcaggctcggcccggctcaagaactccggctcccgccccgagtgcccgtggagc
cgtcttctcaaccagccggtccggaggcgccgctgctgcccgaccggccgggccggcccc
tccccggacgggagccgcgtccgcgggtccgaagagagcggctggaactgcgagcggccc
ccggccgagggcgacggccgcgcccccgccgtctccgctcccccgtccccaccctcccgg
ccggcggcctgtggcgagagcctcctggtctga

DBGET integrated database retrieval system