KEGG   Ovis aries (sheep): 101104941
Entry
101104941         CDS       T03117                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
oas  Ovis aries (sheep)
Pathway
oas00250  Alanine, aspartate and glutamate metabolism
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101104941 (RIMKLA)
Enzymes [BR:oas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     101104941 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     101104941 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 101104941
NCBI-ProteinID: XP_004001904
UniProt: A0A6P3DY43
LinkDB
Position
1:17516642..17552548
AA seq 388 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKGVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKKEPDGCASAQGVVESVYAINSGSTSSESEPELGEIRA
SSASTAGAPVPDPSYNINTRIASELKLK
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggcctgcagctgaaccag
aaggcgctcaccactttcccagatgtggtgcttgtccgcgtgcccacgccctccgtgcag
tcggacagtgacatcaccgtcctgcgacacctggagaagctgggctgccgcttagtcaac
cgcccacagagcattctaaactgcatcaacaaattctggacattccaggagctggctggg
catggggtccccatgccagacaccttctcctatggtggacatgaagacttttcgaaaatg
atcgatgaagccgagccgctgggctaccccgtggtggtgaagagcacgcgcggacaccgg
ggaaaaggtgtttttcttgcaagagataagcaccacctctcagacatctgccacctgatc
cgccacgacgtgccctacctgttccagaagtacgtgaaggagtcccatgggaaagatatc
cgggtggtggtggtcggcggccaggtgataggctccatgcttcgctgctccacagatggc
cggatgcagagcaactgctctctcggtggcgtgggcgtcatgtgcccactgacagaacaa
ggcaagcagctggctatccaggtgtccaacatcctgggcatggacttctgtggcatcgat
cttcttatcatggacgatggctcctttgtggtgtgtgaggcaaatgccaacgtgggcttc
ctagccttcgaccaggcgtgcaacttagatgtgggcgggatcattgcagactacaccatg
tccttgctgcccaacaggcagaccgggaagatggccgtcctcccaggcttgtctagcccc
agggagaagaaagagccagatggctgtgcttcagctcagggagttgtggagagcgtctat
gccatcaacagcgggtctacctccagcgagagtgagcctgaactgggagagatccgggct
tcctcagccagcacagcgggggccccggtgcctgaccccagctacaacattaacaccagg
attgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system