KEGG   Ovis aries (sheep): 101106739
Entry
101106739         CDS       T03117                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X precursor
  KO
K06462  integrin alpha X
Organism
oas  Ovis aries (sheep)
Pathway
oas04610  Complement and coagulation cascades
oas04810  Regulation of actin cytoskeleton
oas05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101106739 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101106739 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101106739 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oas04515]
    101106739 (ITGAX)
   04090 CD molecules [BR:oas04090]
    101106739 (ITGAX)
Cell adhesion molecules [BR:oas04515]
 Integrins
  Integrin alpha subunits
   101106739 (ITGAX)
CD molecules [BR:oas04090]
 Proteins
  101106739 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 101106739
NCBI-ProteinID: NP_001292819
Ensembl: ENSOARG00000009130
UniProt: A0A6P9FQY9 D6BMU9
LinkDB
Position
24:28174339..28193173
AA seq 1158 aa
MTVTQVFLFLLMAPVSSLCFNLDMEQPTTFRVDSPGFGHSVVQYAQWLVVGAPQEVKAAN
QTGGLYWCDYSMGRCEAIPLKVPPEAVNMSLGLSMAATTDPFQLLACGPTVHHACRENMH
LTGICFLLASPFQQVKRIPAALQECPRQDQDIAFLIDGSGSISSRDFNKMLSFVKAVMSQ
FQRPSSQFSLVQFSDRFQEHFTFKDFATSSDPLNLLNSVWQLGGWTFTASAIRFVTDRLL
SAAYGARKDASKILIVITDGEKTEKVDYKEVIPRAEAAGVIRYAIGVGSAFQYRNSLQEL
IDIASTPSKEHVFQVENFDALRDIQKQLKEKIFAIEGTQTISSSSFELEMSQEGFSGVFM
PDGPVLGAVGSFSWSGGAFLYPQNKNPTFINMSQEHVDMRDSYLGYSTELAVWKGVQSLI
LGAPRHQHTGKVVLFTQVSGQWRLKAEVTGTQIGSYFGASLCSVDVNGDSSSDLVLIGAP
HFYEQTQGGQVSVCPFPQGRTKWKCDAVLRGELGHPWGRFGAALTALGDVNGDRLADVAV
GAPGEQENRGAVYLFHGTSELGISPSHSQRVTGAQLSPSLQYFGQSLSGGQDLTQDGLAD
LAVGAQGHALLLRTRPVLRMWANIHITPAEIARSVYECEPLATFPHDLGKATVCLHVSQS
PKNQLVNLQSIVTFDLTLDPGRLSPRAIFQETRTRNLTRVQELGLKQHCEAVRLLLPDCV
EDSVTPIILRLNFSLVGKPISSLRNLQPMLAVDAQRYFTTSLPFEKNCGADHVCQDDLSI
SFGVSDLKTLMVGSNLELNLKVRVWNDGEDSYGTAVTFFYPPGLSYRRVTGGQNHLQSRS
LRLTCDSAPAGTQGTRSTRCSVSHFIFREGAQITFTVTFHVSPTATLGDKLLLVANVSSE
NNSPKTSKTTFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSREAQHRYQVNNLGQR
ELPVSIDISVPMELNQVAVWKDIEVLSPQNPSIQCSSERTAPTESDFLTHFKKKPVLDCS
IADCLRFRCDIPSFGIQEELDFILKGNLSFRWVSQTQQKKVLVVSVAEITFNRLVYSQLP
GQEIFLRAQTELVLEKYEIYNPIPLIVGSSVGGLLLLALITALLYKVGFFKRQYREMMEG
ANKQTVPENETGDPQVAQ
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgacggtgacccaggtttttctcttcctgttgatggccccggtgtcctctctctgcttc
aacttggacatggagcaaccgacaaccttccgtgtggacagccctgggtttggacacagt
gtggtccagtatgcccaatggctggtggttggagccccccaggaggtaaaggctgccaac
caaacaggcggcctctactggtgcgactacagcatgggcaggtgtgaggccatccccctg
aaggtgcctccagaggctgtgaacatgtccctgggcctgtccatggcagccaccaccgac
ccctttcagctactggcctgtggccccactgtgcaccacgcatgccgggagaacatgcac
ttgactgggatctgcttcctgctggcctccccgttccagcaggtcaagaggatcccagct
gccctgcaggagtgcccaaggcaggatcaggacatcgcctttctgatcgacggctcaggc
agcatctcctccagagattttaacaaaatgttgagcttcgtgaaggccgtgatgagccag
ttccagcggcccagctcccagttctccctggtgcagttctcagaccggttccaggagcac
ttcactttcaaagacttcgctaccagctcagacccactaaacctcctgaattccgtctgg
cagctgggagggtggacgttcacggcctcagccatccgattcgtcacagatcgactgctc
agtgccgcctacggggcccgaaaagacgcctccaaaatcctcatcgtcatcactgatggg
gagaaaacagaaaaggtggattacaaggaggtcattccccgggctgaggccgccggcgtc
atccgatatgcaattggggtgggatcagcatttcaatacagaaattccttgcaagaatta
atcgacattgcctccacaccctctaaagagcatgtatttcaagtggagaactttgacgct
ttgcgagacattcagaaacaactgaaagagaagatctttgccattgagggtacgcagacc
ataagcagtagttccttcgaactggagatgtctcaggagggcttcagtggtgtgttcatg
cctgatggaccagttctgggggctgtggggagcttcagctggtctggaggtgctttcctg
tacccccaaaataagaaccccaccttcatcaacatgtcccaggagcatgtggacatgagg
gactcttacctgggttactccacagagctggccgtttggaagggggtccagagcctgatc
ctgggggccccccgccatcagcacaccgggaaggtggtcctcttcacccaggtgtccggg
caatggaggctgaaggctgaagtcacagggacccagatcggctcctacttcggggcctcc
ctctgctctgtggacgtgaatggagatagtagctctgacctggtcctcatcggggcccct
catttctacgagcagacccaggggggccaggtgtctgtgtgcccctttccccaggggagg
actaagtggaagtgtgatgctgtcctgcgaggggagctgggccacccctggggccgcttt
ggggcagccctgaccgcgctgggggatgtgaatggggacaggctggcggatgtggccgtt
ggggccccgggagagcaggagaaccggggtgctgtctacctgttccacggaacctcagaa
ctgggcatcagcccctcccacagccagcgggtcacaggcgcccagctctcccccagcctc
cagtatttcgggcagtcgctgagcgggggtcaggacctcacccaggatggactggcagat
ttggccgtgggggcccaggggcacgcattgctgctcaggaccagacctgtgctcaggatg
tgggcgaacattcacatcacacccgcggagatcgccaggtctgtgtatgagtgtgagccg
ctggcgacctttccccatgatctgggcaaggccactgtctgcctgcatgtttcccaaagt
cccaagaaccagctggttaacctccaaagcattgtgacatttgacttaacccttgaccct
ggccgcctgagtcctcgtgccatcttccaagagacgaggactcggaatctgacccgtgtt
caagagctggggctgaagcagcactgcgaggctgtgaggttgctccttccggactgtgtg
gaggactcggtgacccccatcatcttgcgtctcaacttctccctcgtgggcaagcccatc
tctagcctaagaaacctccagcctatgctggcagtggatgcccagagatacttcacaacc
tctctcccctttgagaagaactgtggcgcagatcatgtctgccaggacgacctcagcatc
tcctttggggtctcagacttgaagaccctgatggtggggagtaacctggagctgaacttg
aaagtgagagtgtggaatgatggcgaggactcctatggaaccgcagtcaccttcttctac
cctccagggttgtcttaccgacgtgtgaccgggggccagaaccatctgcagtcacgttcc
ctgcgcctgacctgtgacagcgcccccgctgggacccagggcacccgaagcacccgctgt
agcgtcagccacttcatcttccgtgagggcgcccagatcaccttcacggtcacctttcac
gtctcccccacggccaccctgggagacaagctgcttcttgtcgccaatgtgagcagtgag
aataacagccccaagacaagcaagaccaccttccagctggagctgcccgtgaagtatgct
gtctacaccgtgatcagcagccacgaacaatccaccaagtacctcaacttctcggcctca
caggaggagggcagcagggaggcccagcacagataccaggtgaataacctggggcagagg
gagctgcctgtcagcatcgacatctcagtgcccatggagctgaaccaggtggccgtgtgg
aaagacatagaggtcctcagcccccagaacccctccattcagtgctcttcagagagaaca
gcacccacagagtctgacttcctgacccactttaagaagaagcctgtcctggactgctcc
atcgctgactgcctgaggttccgctgtgacatcccctccttcggcatccaggaggaactt
gacttcatcctgaagggcaacctcagcttccgctgggtcagccagacacagcagaagaag
gtgctggtcgtgagcgtggctgaaatcaccttcaacagacttgtgtattcgcagcttcca
ggacaggagatatttttgagagctcagacggaactggtgctggagaagtatgagatctac
aaccccatccccctcattgtgggcagctctgtgggaggactgctgctcctggccctcatc
acagccctactgtacaaggttggtttcttcaaacgtcagtacagggaaatgatggaagga
gcaaacaaacagactgtcccagaaaatgagacaggagacccccaagttgcccaataa

DBGET integrated database retrieval system