KEGG   Osmia bicornis bicornis (red mason bee): 114880503
Entry
114880503         CDS       T06109                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
obb  Osmia bicornis bicornis (red mason bee)
Pathway
obb00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:obb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    114880503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:obb00199]
    114880503
Enzymes [BR:obb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     114880503
Cytochrome P450 [BR:obb00199]
 Cytochrome P450, animal type
  CYP306 family
   114880503
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 114880503
NCBI-ProteinID: XP_029052405
LinkDB
Position
Unknown
AA seq 549 aa
MDTDRANDNDQRDKATTRQRISISFQGNLQTLNIKIPFENLTSSTMNYLVYTILFLSSFL
LVYLIRRNRKASSRLPPGPWQLPIVGYLPWIDAEKPHESLTKLSRTYGPVCGFRMGSVYT
VLLSEPRLIKQTLAKDAFAGRAPLYLTHGIMQGYGLVCAEGERWRDQRKFVSSCLRNFGM
VKHEGSRREKMEKRILDAADECVSVLEKRSANGPIDPLDTLHHYMGNFINSIVFGKTYQE
NEPVWKWLRHLQEEGVKEIGVAGPLNFLPFLRFLPRYGKTIRSIVEGKEKTHQIYRSILD
QHRAEIAQSLPKENMTESFLAAFDEQMRKRGPVESAFYTEAQLYHLLADLFGAGTDTTLT
TLRWFLLFMAAHPIEQEKIHLEMNRCLRKQEAPTLNDRSTMPRLEAALAEVQRIRSVTPL
GMPHGTIEDSQIGDYYVPRGSMIIPMQWAVHTDPTYWTNPLEFQPDRFLTKDGNFFKPES
FLPFQNGKRVCIGEELARMILFLFAGRILHAFVVSTPSDVDGVDLEGECGITLVPKPHRL
IFVRRCDDA
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggatacagatagagcgaacgataacgatcaacgcgacaaggcgacaacgcgacaacgc
atcagcatatcctttcaaggtaatttgcagacactcaatatcaagataccgtttgagaat
ctaacgtcgtccacgatgaactacttggtttacacgatattattcctatcttcgttcctt
ctggtataccttattcgtagaaatcgaaaggcatcatctcgtctccctcccggtccctgg
caacttccgatcgttggctatctaccgtggatcgacgcagagaaaccgcacgaatctctc
acgaaattatccaggacttatggacccgtatgtggatttcgtatgggttcggtctatact
gttttactgtcggagcctcgattgataaagcaaactcttgcaaaggatgcgtttgctggc
agagcaccgctctatcttactcatggaatcatgcaaggatatggtttggtttgtgccgag
ggtgaacgatggagagatcaaaggaaattcgttagtagctgcctaagaaatttcggtatg
gtgaaacacgaaggatctagaagagaaaaaatggagaaaagaatactcgatgcagccgac
gaatgtgtatcggtgctcgaaaagcgttcagcgaatggaccgatcgatccattggacacg
cttcatcattacatgggtaattttatcaatagtatcgtgtttggaaaaacttaccaagag
aacgaaccagtttggaaatggttgagacatttgcaagaagaaggagtaaaagagataggc
gttgccggacctctgaattttttaccttttctcagattcttaccacgatacggaaaaacg
attcgatcgatcgtcgagggtaaagaaaaaacgcatcagatataccggtcgatactcgat
cagcatcgtgcagaaatcgcgcaaagcttgccaaaggaaaacatgaccgagagctttttg
gccgcgttcgacgaacaaatgagaaaaagagggcccgtagaatcggccttttatacggaa
gctcagctgtaccatttgttggcggatctttttggtgccggaaccgataccaccttgacg
acgcttcgttggttccttctattcatggctgcccatcctatagaacaggaaaaaatccat
ttggaaatgaatcggtgtttgagaaaacaagaagcaccgacattgaacgataggagcact
atgcctcgtctcgaagccgctttagcagaagtgcaaagaataagaagcgttacaccgctc
ggtatgccccatggaacgatagaggattcacaaataggtgattactatgtgccccgtggc
tccatgataattccgatgcaatgggccgttcatactgatcctacttactggacaaatcct
ctcgagtttcaaccggacagattcttaacaaaagatggaaacttcttcaaaccggaatcg
tttctcccctttcaaaatggaaaacgagtctgcatcggagaggaactcgccaggatgata
ctatttctgttcgctggaaggatattgcacgcgttcgttgtatcgacaccatcggacgtc
gatggtgtcgacctcgaaggcgaatgcggtattacgctcgtcccaaagccacatcgtttg
atatttgtcagacgatgtgatgacgcctga

DBGET integrated database retrieval system