Ovis canadensis (bighorn sheep): 138417727 Help Entry 138417727         CDS       T11679                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism ocan  Ovis canadensis (bighorn sheep) Pathway ocan04080   Neuroactive ligand-receptor interaction ocan04081   Hormone signaling ocan04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ocan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     138417727 (GHRH)    04081 Hormone signaling     138417727 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     138417727 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocan04052]     138417727 (GHRH) Cytokines and neuropeptides [BR:ocan04052]  Neuropeptides   GPCR binding    138417727 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 pKID Motif Other DBs NCBI-GeneID:  138417727 NCBI-ProteinID:  XP_069404639 LinkDB All DBs Position 13:complement(81566158..81570880) Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSQGSLPSQPLRIPRYADAIFTNSYRKILGQLSARKLLQDIMNRQ QGERNQEQGAKVRLGRQVDSVWTDQQQMALESILVSLLQERRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagtagcggctcccaaggttcc ctgccctcccagcctctcaggatcccacggtacgcagatgccatcttcactaacagctac cggaagattctgggccagctgtctgcccgcaagctactccaggatatcatgaacaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacagc gtgtggacagaccaacagcagatggcattggagagcatcttggtgagcctgctgcaggag cgcaggaattcccaaggatga

DBGET integrated database retrieval system