KEGG   Oryctolagus cuniculus (rabbit): 100008595
Entry
100008595         CDS       T03373                                 
Symbol
TNFSF4, TNLG2B
Name
(RefSeq) tumor necrosis factor superfamily member 4
  KO
K05469  tumor necrosis factor ligand superfamily member 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008595 (TNFSF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008595 (TNFSF4)
   04090 CD molecules [BR:ocu04090]
    100008595 (TNFSF4)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100008595 (TNFSF4)
CD molecules [BR:ocu04090]
 Proteins
  100008595 (TNFSF4)
SSDB
Motif
Pfam: C1q GOLD_2
Other DBs
NCBI-GeneID: 100008595
NCBI-ProteinID: NP_001075454
UniProt: O02765 A0A0U5J5S0
LinkDB
Position
13:complement(702363..716883)
AA seq 187 aa
MEGVRPLEENVGNAPRPRFERNKLLLVASVVQALGLLLCLTYVCQHSHAPEVSLQYPPIE
NIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSIS
LHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQN
PGGYCAP
NT seq 564 nt   +upstreamnt  +downstreamnt
atggaaggggtccgacccctagaagagaatgtgggaaacgcaccaaggccaaggtttgag
agaaacaagctattgctggtggcctccgtagttcaggcactggggctgcttctgtgcctc
acctacgtctgccagcactcccatgctcccgaggtgtcacttcagtatcctccaattgaa
aatatcatgacacaacttcaaatcttaacatcccatgagtgtgaagaggacagtttcatc
ctcccactccaaaaaagggacggaaccatggaagtgcaaaacaactcagtcgtcatccag
tgtgatggcttttatctcctgtctctgaagggctacttctcccaggaggtcagcattagt
cttcactatcggaagggtgaggagcccttcccgatcctgaagaagaccaagtttgccaac
tccaacgtggtgttaaaattgggttacaaagacaaagtctacctgaatgtgaccaccgac
agcgcctcctgcaagcagctcagtgtgaatgctggggagctgattgtcatccttcaaaat
cccggtgggtactgcgctccctga

DBGET integrated database retrieval system