KEGG   Oryctolagus cuniculus (rabbit): 100008601
Entry
100008601         CDS       T03373                                 
Symbol
AOX1
Name
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00280  Valine, leucine and isoleucine degradation
ocu00350  Tyrosine metabolism
ocu00380  Tryptophan metabolism
ocu00750  Vitamin B6 metabolism
ocu00760  Nicotinate and nicotinamide metabolism
ocu00830  Retinol metabolism
ocu00982  Drug metabolism - cytochrome P450
ocu01100  Metabolic pathways
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100008601 (AOX1)
   00350 Tyrosine metabolism
    100008601 (AOX1)
   00380 Tryptophan metabolism
    100008601 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100008601 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100008601 (AOX1)
   00830 Retinol metabolism
    100008601 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100008601 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100008601 (AOX1)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100008601 (AOX1)
SSDB
Motif
Pfam: MoCoBD_1 MoCoBD_2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 100008601
NCBI-ProteinID: NP_001075459
Ensembl: ENSOCUG00000013971
UniProt: P80456
LinkDB
Position
7:141217000..141288933
AA seq 1334 aa
MEPAPELLFYVNGRKVVEKQVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
RVTKKIRHYPVNACLTPICSLYGAAVTTVEGIGSTTTRLHPVQERIAKFHGTQCGFCTPG
MVMSMYALLRNHPEPTLDQLADALGGNLCRCTGYRPIIEAYKTFCKTSDCCQNKENGFCC
LDQGINGLPEVEEENQTRPNLFSEEEYLPLDPTQELIFPPELMTMAEKQPQRTRVFSGER
MMWISPVTLKALLEAKSTYPQAPVVMGNTSVGPGVKFKGIFHPVIISPDSIEELNVVSHT
HSGLTLGAGLSLAQVKDILADVVQKVPEENAQTYRALLKHLGTLAGSQIRNMASLGGHII
SRHLDSDLNPLLAVGNCTLNVLSKEGERQIPLDEQFLSRCPEADLKPQEILASVHIPYSR
KWEFVLAFRQAQRKQNALAIVNSGMRVFFGEGDGIIRELAISYGGVGPTIICAKNSCQKL
IGRSWNEEMLDTACRLILDEVSLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKRMAPG
LSPHLADKYESALQDLHARYSWSTLKDQDVDARQLSQDPIGHPVMHLSGVKHATGEAIYL
DDMPAVDQELFMAFVTSPRAHAKIVSTDLLEALSLPGVVDIVTAEHLQDGNTFYTEKLLA
ADEVLCVGQLVCAVIAESEVQAKQAAKQVKIVYEDLEPVILSIEEAIEQKSFFEPERKLE
YGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSVLVVPKGEDQEMDVYASTQFPKYIQDM
VAAVLKLPVNKVMCHVKRVGGAFGGKVFKASIMAAIAAFAANKHGRAVRCILERGEDMLI
TGGRHPYLGKYKAGFMNDGRIVALDVEHYSNGGCSLDESLLVIEMGLLKMENAYKFPNLR
CRGWACRTNLPSNTAFRGFGFPQAGLITECCITEVAAKCGLSPEKVRAINFYKEIDQTPY
KQEINAKNLTQCWNECLAKSSYFQRKVAVEKFNAENYWKQRGLAIIPFKYPRGLGSVAYG
QAAALVHVYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELKMPMSNVHLRGTSTETVPNTN
ASGGSVVADLNGLAVKDACQTLLKRLEPIINKNPQGTWKEWAQAAFDKSISLSATGYFRG
YDSNIDWDKGEGHPFEYFVYGAACSEVEIDCLTGDHKTIRTDIVMDVGYSINPALDIGQV
EGAFIQGMGLYTIEELHYSPQGILYSRGPNQYKIPAICDIPAELNVTFLPPSEKSNTLYS
SKGLGESGVFMGCSVFFAIREAVCAARQARGLSAPWKLSSPLTPEKIRMACEDKFTKMIP
RDKPGSYVPWNVPV
NT seq 4005 nt   +upstreamnt  +downstreamnt
atggagccggcgcccgagctgctcttctacgtgaacggccgcaaggtagtagaaaaacaa
gttgatcctgaaacaatgctgctaccatatctgaggaagaagctgcgactcacaggaacc
aagtatggctgcggagggggaggctgtggggcctgcacagtgatgatctcaagatataac
cgcgtcaccaagaaaataagacattacccagtcaatgcctgtctgacccccatctgttct
ctgtacggtgcggcagtcactacagtggaaggcataggaagcaccacaacgcgacttcat
cctgtccaggagaggattgccaagtttcacggcacccagtgtggattctgtaccccgggg
atggtgatgtccatgtatgcactgctcaggaaccatccggagcccactctggatcagctg
gctgatgcccttggaggtaatctgtgtcgttgcactggatacaggccaataattgaggca
tacaagactttctgtaaaacttctgactgctgtcaaaataaagaaaatgggttttgctgt
ttggatcaaggaataaatggattgccagaagttgaggaagaaaatcagacaaggccaaac
ctcttctcagaagaggagtacctgccgctggatccaacccaggaactgatatttcctcct
gagctaatgacaatggctgagaaacaaccccagaggaccagggtttttagtggtgaaaga
atgatgtggatttccccagtgaccctgaaggcacttctggaagctaagtccacgtatcct
caggcccctgttgtcatgggcaacacctctgtggggcctggggtgaaatttaaaggcatc
tttcacccagttataatttctcctgatagtattgaagaactgaatgttgtcagccataca
cacagtggactgacgctgggtgctggccttagcctggcccaagtgaaggacatcctagct
gatgtggttcagaaggttccggaggaaaacgcgcagacgtaccgcgccctcctgaagcac
ttgggaaccttggcgggatctcagatcagaaacatggcatctttagggggccacatcatc
agcaggcatctggattcagatctgaatcccctcctggctgtgggtaactgcaccctcaat
gtgctgtcgaaagaaggagagcgccagattcccttagatgagcagtttctcagcaggtgt
cccgaggctgatctgaagccgcaagagatcttggcctcagtgcacatcccctactccagg
aagtgggaattcgtgttagccttccgacaagcccagcggaaacagaacgcgctagccata
gtcaactcaggaatgagagtcttttttggagaaggggatggcatcattagagagttggcc
atatcatatggtggcgttggtccaaccatcatctgcgccaagaattcctgccagaaactc
attggaaggtcctggaatgaagagatgctggacacagcttgcaggttgattctagatgaa
gtctcccttccaggctcagcaccaggtgggaaggtggagttcaagaggaccctcatcatc
agcttcctcttcaagttctacctggaagtgtcccagattttgaagaggatggccccaggt
ctgtctccccaccttgcagacaagtatgagagtgccctgcaagatctccatgccagatac
agctggagcacactgaaggaccaggatgtagatgcaaggcagctttcgcaagacccaatt
ggccatcctgtcatgcacctgtctggtgttaaacatgccacgggggaagccatctacctt
gatgacatgcctgcagtagaccaggaactcttcatggcttttgtaactagtccaagagct
catgctaagattgtgtctactgatctgttggaagccctcagcctgccgggcgtggtggac
attgtgacagcagagcaccttcaggatgggaacacgttctacacagagaagcttctggca
gcagatgaggtgttgtgtgtgggtcaactggtctgtgccgtgatcgcagaatccgaagtg
caggcaaagcaagctgctaagcaagtgaagatcgtctatgaagacctggaaccggtgatc
ctgtcgatcgaggaggctatagagcaaaaatcctttttcgagccagaaaggaaactggaa
tatggaaatgttgatgaagcatttaaagtggttgatcaaattcttgaaggtgaaatacat
atgggaggtcaggaacatttttatatggaaacccagtctgtgcttgttgtgcccaaagga
gaggatcaagaaatggatgtctatgcatctacacagtttcccaaatacatccaggacatg
gttgccgcagtcttgaagctcccagtgaacaaggtcatgtgccacgtcaaacgtgttggt
ggggcatttggggggaaggtgttcaaagccagcattatggcagctattgccgcatttgct
gccaacaagcatggtcgtgcagtccgctgcattctggaacgaggagaagacatgttaatt
actggagggcgccatccttaccttggaaagtacaaagctggattcatgaacgatggcagg
atcgtggccttggatgtggaacattatagcaatggaggctgctccctggatgagtcatta
ttggtcatagaaatgggactcctgaaaatggaaaacgcctacaagtttcccaacctgcgc
tgccggggttgggcgtgcagaaccaaccttccctccaacacggctttccgcggcttcggc
tttccccaggcggggctcatcaccgagtgctgtatcacggaagttgcagccaaatgcggt
ttgtcccccgagaaggtccgagccataaacttttacaaggaaattgaccaaactccctat
aaacaagagataaatgccaagaacctgacccagtgttggaacgaatgtctggccaagtct
tcctacttccagaggaaagtggctgtggaaaagttcaatgccgagaattactggaagcag
agagggctggccatcatccccttcaagtatccccgtggccttggctcagtcgcctatggt
caggctgctgccctggttcacgtgtatcttgatggttctgttctggtcactcacggtggg
attgaaatggggcagggtgtccacactaaaatgattcaggtggtcagccgtgaactgaag
atgccaatgtcaaatgtccacctgcgtggcacaagcacagaaactgtccctaatactaat
gcctctggaggatctgtggtggcagatctcaacggactggcagtaaaggatgcttgtcaa
actcttctgaaacgcctggaacccatcatcaacaagaatccccaaggaacttggaaggag
tgggcccaggctgcctttgacaagagcatcagcctgtcagcgactggctacttcaggggc
tatgactcaaacatcgactgggacaaaggtgaaggccatcccttcgaatacttcgtttat
ggagctgcctgttccgaggtggagatagactgcctgacaggggaccataagacaatcaga
acggacattgtcatggatgttggctacagtataaatccagcccttgacataggccaggtt
gaaggtgccttcattcaaggcatgggactttacaccatagaggaactgcattactcccct
cagggcatcctttactctcgtggtccgaaccaatacaaaatccctgccatttgtgacatc
cccgccgagttaaacgttacctttttgcctccatctgagaagtccaataccctgtactcc
tcgaagggcctgggagagtctggggtgttcatgggctgctcggtgtttttcgccatccgg
gaggcagtgtgtgcagcccggcaggcgagaggcctctctgcgccttggaagctcagcagt
ccgctcaccccagagaagatcagaatggcctgtgaagacaagttcactaaaatgattcca
agagataagccaggctcctacgttccttggaatgtacccgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100345417
Entry
100345417         CDS       T03373                                 
Symbol
AOX2
Name
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00280  Valine, leucine and isoleucine degradation
ocu00350  Tyrosine metabolism
ocu00380  Tryptophan metabolism
ocu00750  Vitamin B6 metabolism
ocu00760  Nicotinate and nicotinamide metabolism
ocu00830  Retinol metabolism
ocu00982  Drug metabolism - cytochrome P450
ocu01100  Metabolic pathways
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100345417 (AOX2)
   00350 Tyrosine metabolism
    100345417 (AOX2)
   00380 Tryptophan metabolism
    100345417 (AOX2)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100345417 (AOX2)
   00760 Nicotinate and nicotinamide metabolism
    100345417 (AOX2)
   00830 Retinol metabolism
    100345417 (AOX2)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100345417 (AOX2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100345417 (AOX2)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100345417 (AOX2)
SSDB
Motif
Pfam: MoCoBD_1 MoCoBD_2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 100345417
NCBI-ProteinID: NP_001284417
Ensembl: ENSOCUG00000026480
UniProt: G1U6Q8
LinkDB
Position
7:141502585..141581949
AA seq 1343 aa
MPCPSRPSDLVFFVNGRKVIERNADPEVTLLTFLRKNLRLTGTKYACGTGGCGACTVMVS
EHDPISKKIRHVSVTACLVPICSLYGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGKTFCAESNGCQQNRTG
KCCLDQGENGSSSPGRKNVLCTELFSKEEFQPLDPTQDLIFPPELLRMAENPEKPTLTFY
GERVTWISPGTLKELLELKVRHPEAPVVLGSTSLGPAMKSQGHFYPILLSAARISELRMV
TKTSDGLTIGAGCSLAQVKDILVERISELPEEKTQTYRALVRHLQSLAGQQIRNLASLGG
HVISRHCYSDLNPILAVGNVTLNLISEDGARRTPLDEHFLAGLASADPKPQEILESVYIP
HSQKWEFVSAFRQAQCQQNALPDVTASMRVLFREGTDTVEDLSIAYGGVGAAPIIARKSC
QQLLGRRWNELMLDEACRLLLEEVRLMGSAPGGRVEFKRTLVVSFFFKFYLEVLQELKKL
AKLCSDSRHHPEIADRFLSALQDFPVTVPQGVQMYQSVDSQQPLQDPVGRPIMHLSGLKH
ATGEAEFCDDIPMVDKELFMALVTSTRAHAKIISIDLSEALELPEVVDVITADDIPGTNG
AEDDKLLAVDKVLCVGQIICAVVAETDVQATRAAGKIKITYEDLEPMVFTIEDAIKHNSF
LCPEKKLEQGNVEKAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKAEDKELDIHVSTQ
DPAHVQKTVSSTLNIPLNRITCHVKRVGGGFGGKVVRPAAFGAIAAVGAVKTGRPVRLVL
DREDDMLITGGRHPLFGKYKVGFMNNGRIKALDVECYVNGGCTLDDSELVTEFLILKLEN
AYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLVTEACITAVAAKCGLLPEQIREKNMY
KTVDKTIYKQAFSPEALIRCWAECLDKSCFHSRRIQVDEFNKQNYWRKKGLAVIPMKFSV
GFAATTFHQAAALVHVYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSYMHLCETN
TATVPNTIATAASIGADVNGRAVQNACQVLLKRLEPIIKKNPDGSWKDWIGAAFEKRISL
SATGYFRGYKAFMDWDKGEGDPFPYYVYGASCSEVEIDCLTGAHRKIRTDIVMDACCSLN
PAIDIGQIEGSFIQGMGLYTTEELHYSPEGILLSRSPNEYKIPTVTDVPEVFNVSLLPSS
QTPLTIYSSKGLGESGMFLGSSVFFAIADAVAAARRERDMAEDFTVTSPATPERVRMACA
DRFTEMIPRDDPKTFKPWSIPVA
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgccctgcccatcaaggcccagtgacttggttttctttgtgaatgggaggaaggtgata
gagaggaatgcagacccagaagtgacactgctgaccttcctacgaaagaacttacgtctc
acagggaccaagtatgcctgcggaacaggaggctgtggcgcctgcactgtgatggtgtcg
gagcatgaccccatatccaagaagataaggcatgtctctgtcaccgcctgcctggtgccc
atctgctcactgtatggagctgctgtcaccaccgtggaaggtgttggaagcatcaaaacc
aggcttcacccggtgcaggagaggattgccaagagccatggcacccagtgcggattctgc
acccctgggatggtgatgtccatgtacacgctgctcaggaaccatccacagccctcagag
gagcagctcatggaagccctgggaggtaacctgtgccgctgcactgggtatcggcccatt
ctcgagagcgggaagaccttctgcgcggagtcaaatggctgtcaacagaacagaacagga
aaatgctgcttggaccagggagaaaatgggtcctcgtcccccggcagaaagaatgtcctt
tgcacggagttattttcgaaagaggagttccagcctttggaccctacccaggaccttata
ttccctccagagctcttgaggatggcagagaacccagaaaaaccaaccctgactttttat
ggagagagagtgacttggatctcccctgggaccctcaaggagctcctggagctgaaagtg
aggcacccggaagcccctgtcgtcctgggcagcacctcgctgggacctgcaatgaaatct
caaggacatttttacccgattctcctctctgctgctaggatctctgagctgcggatggta
acaaaaacaagtgatggtctaacgattggggctggctgcagcctggcgcaggtgaaggac
atcttggttgagaggatatctgagctcccggaggagaaaacccagacctaccgagccctc
gtaaggcacctgcagtctctggcgggccagcagatccggaatctggcgtccctaggagga
catgttataagccgccactgctactcagacctgaatccgattcttgctgtgggcaatgtg
actctgaatctgatatctgaagatggagcgcggcgcactcccctggatgaacatttcctg
gctggcttggcgagcgcggaccccaagccgcaggaaatcttggagtccgtgtacatccct
cactcgcaaaagtgggaattcgtgtcagccttccgacaggctcagtgccagcagaacgcc
ctgcccgacgtaactgccagcatgcgtgtgcttttcagagaaggcacagacaccgtagag
gacctgagcattgcctatggaggcgtgggggccgcccccatcatcgcgcgaaaatcctgc
caacagctcctggggaggcgctggaatgagctgatgctggatgaggcttgcaggctgctt
ctggaggaagtccgcctcatgggctcggctccaggtggccgggtagaattcaagaggacc
ctggtggtcagcttcttcttcaaattctacctggaggttttgcaggagctgaagaagctg
gcaaagctgtgctctgacagccgtcatcatcctgagattgcagaccggttcctaagtgca
ctacaagatttcccagtcacagtgccccagggagtgcaaatgtaccagagtgtggattct
cagcaacctctccaagatccagttggacgccccatcatgcacctgtcgggtctgaaacat
gccacaggcgaagctgaattttgtgatgacatccccatggtggataaggaacttttcatg
gctttggtgaccagtaccagggctcacgccaaaatcatatcaatagatttgtctgaggcc
ctcgaactaccagaggtggttgatgtgataacagctgatgacattccaggcaccaacggt
gctgaagatgacaaattactggctgtggacaaggtactttgtgtgggccagatcatctgt
gctgtggttgcagagacagacgtgcaggccacgcgagcagctggaaagatcaagatcact
tatgaggatctggagcccatggtcttcaccattgaggacgccataaaacacaattcattc
ctatgccctgaaaaaaaacttgaacaaggaaatgtcgagaaggcatttgaaaaagtggat
caaattgttgaaggagaggtccacgttggcggacaagagcatttttatatggaaacacaa
agagtgcttgtaattccaaaggccgaagacaaagagctggacattcacgtgtctacccag
gatccagcccacgtgcagaaaacagtgtcgtccacgttaaacatccccctcaacaggatc
acctgtcatgtgaaacgagtgggtggaggtttcggagggaaggtggtcaggccagctgca
tttggagccattgcagcagtaggcgctgttaaaactggccgtcccgttcgtctggttctt
gatcgtgaagatgacatgttaataaccgggggaaggcacccattatttggaaaatacaaa
gtgggcttcatgaacaacgggcgcatcaaagctctggacgtggaatgctatgttaacgga
ggatgcacgctggatgactccgagctggtaacagaatttctcatactaaagctggaaaat
gcatataagatccgcaacctcaggttccggggccgagcatgcatgacaaacttaccttcc
aatacggccttccgtggatttggcttcccacaggggaccctggtgacagaagcttgcatc
acagctgtggcagccaaatgtggcctccttccagaacagatcagggagaaaaacatgtac
aaaacagttgacaaaaccatctacaaacaagccttcagccctgaggccctgataagatgt
tgggcagaatgcctggacaagtcgtgctttcacagccgaagaattcaagtggacgagttc
aacaagcagaattactggaggaagaaaggccttgctgtcatccccatgaagttctcggtt
ggctttgctgcgaccacctttcatcaggctgcggcactcgtccatgtctacacggacggg
tctgtgctggtcactcacggaggcaatgaactgggacaaggaattcacaccaaaatgctc
caggtggccagccgcgaattaaaaatacccatgtcttacatgcacctctgcgaaacaaac
acagcaactgtgccgaacacgattgctacagcagcatccattggtgcagatgtcaacggc
cgagcagtgcagaacgcgtgccaggtgcttctgaaacgcctggagcccatcattaaaaaa
aatccagacggttcatggaaggactggattggagctgcattcgagaaacgaatcagtctc
tcagccactggatatttcaggggttacaaggccttcatggactgggacaagggggaaggg
gacccgttcccctactacgtctacggagcctcctgctcagaggtggaaatcgactgcctg
acaggcgctcacagaaaaatcagaacggacatcgtcatggatgcatgttgcagtctaaat
ccagctattgacattgggcagatcgaaggttccttcattcagggaatgggcctttacacc
accgaagagctgcactactcccccgaaggcatccttctgtctcggagcccgaatgagtac
aaaattccaaccgtcactgatgtcccggaggtgtttaatgtctccctcttgccatcatcc
caaaccccgctgaccatctattcatccaagggcctcggagagtctggaatgttcctgggg
tcctctgtcttctttgccattgccgacgcagtggcggcagcacgcagagaaagagacatg
gccgaggacttcacggtgacgagcccagccacgccggagcgggttcggatggcctgtgca
gaccgcttcacagaaatgattccaagagatgatcctaagacatttaaaccttggtcgatc
cctgtagcataa

KEGG   Oryctolagus cuniculus (rabbit): 100345675
Entry
100345675         CDS       T03373                                 
Symbol
AOX3
Name
(RefSeq) aldehyde oxidase 3
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00280  Valine, leucine and isoleucine degradation
ocu00350  Tyrosine metabolism
ocu00380  Tryptophan metabolism
ocu00750  Vitamin B6 metabolism
ocu00760  Nicotinate and nicotinamide metabolism
ocu00830  Retinol metabolism
ocu00982  Drug metabolism - cytochrome P450
ocu01100  Metabolic pathways
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100345675 (AOX3)
   00350 Tyrosine metabolism
    100345675 (AOX3)
   00380 Tryptophan metabolism
    100345675 (AOX3)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100345675 (AOX3)
   00760 Nicotinate and nicotinamide metabolism
    100345675 (AOX3)
   00830 Retinol metabolism
    100345675 (AOX3)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100345675 (AOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100345675 (AOX3)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100345675 (AOX3)
SSDB
Motif
Pfam: MoCoBD_1 MoCoBD_2 FAD_binding_5 CO_deh_flav_C Ald_Xan_dh_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 100345675
NCBI-ProteinID: NP_001295389
UniProt: A0A5F9CFN6
LinkDB
Position
7:141293821..141423314
AA seq 1335 aa
MSHSKESDELVFFVNGRKIVERSSDPEENLLFYLRKKLRLTGTKYGCGGGSCGACTVMIS
RYDPISKKIRHFSVTACLVPICSLYGAAVTTVEGIGSTKTRIHPVQERIAKGHGTQCGFC
TPGMVMSIYTLLRNHPEPSTEQLMETLGGNLCRCTGYRPIVESGRSFSPSSSCCQMNGGK
KCCLDQEESKAESKANVCTKLYDKEEFQPLDPTQELIFPPELMRMAEDPQKKVLTFHGEK
TTWISPGTLAGLLELKMEHPDAPLVMGNTSLGPDMKFKGVSPPIIISPARILELFIVTNT
EEGLTLGAGLRLAQVRDVLADAVSELPEEKTQTYRALLKHMRTLAGQQIRNMASLGGHII
SRLPTSDLNPILGVGNCILNVASKEGMQQIPLNDHFLAGATNASLKPEQVLVSVFIPISR
KWEFVSAFRQAPRQQNALAIVNAGMRVLLKDGTHTIADLNILYGGVGPTTVSARESCQRL
LGRCWDEDMLNEACRLVLDEIPLPASAPGGRVDYRRALLISFLFKFYIDVWRQLQMREPS
GYPDIPKKLLSALEDFPLTIPWGIQSFERMDPQQPSQDPVGRPIMHQSGIKHATGEAVFC
DDMPALADELFLAVVTSTRPHAKIISIDASEALALPGVIDVITAQDVPGENGSEEERLYA
QDEVICVGQIVCAVAADSYAHAKQATRKVKIVYKDVEPVIVSIQDAIKHKSFIGPEKKLE
QGDVEKAFQAVDQIIEGEVHFGGQEHFYLETQSVRVVPKAEDAEMDVYVSSQDAAFTQEM
VACALGIPKNRINCHVRRVGGAFGGKSSKPGLLAAVAAVAANKTGCPVRFVLERGDDMLI
TGGRHPLLGKYKIGFMNNGKIEAADIEYHINGGCTPDDSELVIEYALLKLENAYKIPNLR
VQGRACKTNLPSNTAFRGFGFPQGAFVTETWMSAVAAKCHLPPEKVRELNMYRTVDRTIH
KQEFNPENLIRCWEKCMENSSYCSRRKAIEEFNEQNYWKKRGIAIIPMKFSVGFPKTFYY
QAAALVHIYTDGSVLVAHGGVELGQGINTKMIQVASRELKVPMSYIHIGEMNTVTVPNTI
TTAASAGADVNGKAVQSACQTLRKRLQPIISQTPNGTWEQWVNEAFAQSISLSATGYFRG
YEARMDWEKGEGDIFPYFVFGAACSEVEIDCLTGAHKNIRTDIVIDASFSINPAVDIGQI
EGAFTQGVGLYTLEELKYSPEGVLHTRGPEQYQIPSVTDIPEELHVSLLTTTQNPKAIYS
SKGLGESGMFLGSSVFFAITDAVAAARSERGLPPALAMNSPATPELIRMACVDQFTDLIP
QTDSKCSELWSIPIA
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgtctcattccaaggagtcagacgaacttgttttctttgtgaatgggagaaagatcgtg
gagaggagttctgaccctgaagaaaacttactgttctatctgagaaagaaactccgactc
acagggaccaagtatggctgtggaggagggtcctgtggtgcctgcacagtgatgatctca
agatatgaccccatctctaagaagatacgtcacttctctgtcaccgcctgcctggtgccc
atctgctctctctatggggccgctgtcaccaccgtagaaggcataggaagcaccaaaacc
aggattcaccctgttcaggaaaggattgctaaaggccacggtacccagtgtgggttctgc
accccaggaatggtgatgagcatctatactctcctgaggaaccacccggagccctctaca
gaacagttaatggaaaccttgggtggtaatctatgccgctgtactggatacagacccatt
gtggagagcgggagaagttttagtcctagttcctcttgctgccaaatgaatgggggaaag
aaatgttgcttggatcaagaagaaagcaaggctgagagcaaagctaatgtttgcaccaag
ctgtatgacaaggaagaattccagcccttggacccaacacaggagcttatatttccacct
gaactaatgagaatggcagaagatccccaaaagaaagttctgactttccacggggagaag
actacctggatttccccaggaaccctggcaggcctcctggagctgaagatggagcacccc
gatgcacctctggtgatggggaacacttctctagggcctgatatgaagttcaaaggagtt
tcccctcccattattatctctcctgcaaggatattggaattatttattgtgactaacaca
gaagaagggctgaccctgggtgctggcctcaggctggcccaggtgagggacgtcctggct
gatgcggtctctgagctcccggaggagaagacgcagacgtatcgcgctctcttgaagcac
atgaggaccctggcgggacagcagatcaggaacatggcatccttaggtggtcatataatt
agcaggctgccgacttctgatctcaaccccattttgggagtaggcaattgcatcctcaat
gttgcttcaaaagaaggaatgcagcaaattcctttgaatgatcattttcttgctggagca
acaaatgcaagccttaagccagaacaagtcctagtttctgtgttcattcctatctctaga
aagtgggagtttgtgtcagctttcagacaggccccccgccagcaaaatgcccttgcaatc
gtgaatgctgggatgagagtccttctcaaagatggcacacacaccattgcggacttgaac
atcttatacggaggagtgggtcctactactgtcagtgccagggaatcctgccagcggctc
cttggaagatgctgggatgaagacatgttgaatgaagcttgcaggctggtcctggatgag
atcccacttccggcgtccgcccctggagggagggtggactaccgccgagctctcctgatc
agcttcctcttcaaattctacatcgacgtgtggcggcagttacagatgagggaaccaagt
ggctaccctgacattcccaagaaactcttaagtgccctggaagactttccattgaccatt
ccttgggggatacagtcattcgagcgtatggatccccagcagccctcccaagacccagtg
ggacgccccatcatgcatcagtcaggcattaaacacgccacaggggaggctgtattctgt
gatgacatgcctgccttggcagacgaactcttcctggctgtggtgaccagcaccaggccg
catgccaaaatcatttccattgatgcctctgaggccctggcactgcctggtgtcatcgat
gtgataacggcgcaggatgttcctggtgaaaatggcagtgaggaagaaagattgtatgca
caggatgaggtgatttgtgtgggtcagattgtctgtgctgtggctgctgactcgtacgcc
catgccaagcaagccacgagaaaggtgaagattgtgtacaaagatgtggaacctgtgatt
gtgagcattcaggatgcaataaaacacaaatcattcattggtcctgaaaagaaactagaa
caaggagatgttgagaaggcatttcaagctgttgatcaaatcattgaaggggaagtacac
tttggaggacaggagcatttctacctggagacgcaaagtgtgcgcgtggtgccaaaggcg
gaggatgcagagatggacgtctacgtgtcaagccaggatgcagcctttacacaggaaatg
gtggcttgtgccttgggcattccaaagaacaggatcaactgccacgtgagaagggtcggc
ggggctttcggagggaaatcgagcaagcctgggctcctggcagcagtggcagctgtggcg
gcaaacaagactggctgcccagtgcgttttgttctcgagcgtggggacgacatgttgatc
actggaggacgccacccattactggggaaatacaagattggcttcatgaacaacgggaaa
atcgaggcagcagacattgaatatcatatcaacggaggctgcacaccagatgactctgaa
ctggtaatagaatatgctttgctcaaactggaaaatgcttataagatccccaacctgcgt
gtccaaggccgagcctgcaagaccaacttgccgtccaatacggccttccgggggttcggg
tttccccagggagcctttgtaacagagacctggatgtcagctgtggcagccaaatgccat
ctgccgccagaaaaggttagagagttgaacatgtacaggacagttgataggacaatccac
aagcaagaattcaatccagagaatctgataagatgctgggagaaatgtatggaaaattct
tcatactgcagcaggagaaaagctatagaggaatttaacgagcagaactattggaagaag
cgaggaatagccattatccccatgaaattctccgttggatttccaaagactttttattat
caggctgctgctctggtccacatctacacagatggatctgtgttggttgctcatggtgga
gttgaattgggtcaaggtattaacaccaaaatgatacaggtggccagccgtgagctaaag
gtaccaatgtcctacatacacatcggcgagatgaataccgtgacagtgcccaacacaatt
accaccgcagcctccgctggtgcagatgtcaatggaaaagctgtacagagtgcctgccag
actctccggaaacgcctgcagcccatcatcagccagactcctaatggcacctgggagcag
tgggttaatgaagcttttgctcaaagcattagtctctccgccaccggatattttagaggt
tacgaggctcgcatggactgggagaagggagaaggtgacatatttccttactttgttttt
ggagctgcttgttctgaggttgaaatagactgtctgacgggtgcccataagaacatcaga
actgatatcgtcatagatgcttctttcagtataaatcctgctgtggacataggacagatt
gaaggggcctttactcaaggtgttggactttacaccctggaggaactaaaatactctccc
gagggagtcctacacacccgtggtccagagcagtaccaaatcccttcggttactgatatc
ccagaggagctgcatgtgtccctgctgacaacaacacaaaacccaaaagcaatctactcc
tccaagggcctaggtgaatccggaatgtttctggggtcttccgtattcttcgccatcact
gacgctgtagccgcagctcgcagcgagaggggcctgccccctgccttggcgatgaacagc
cctgccactccagagctcatccggatggcctgtgtggatcagttcacggacctgattcca
caaactgattctaaatgctctgagctgtggtccatccccattgcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354428
Entry
100354428         CDS       T03373                                 
Symbol
AOX4
Name
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00280  Valine, leucine and isoleucine degradation
ocu00350  Tyrosine metabolism
ocu00380  Tryptophan metabolism
ocu00750  Vitamin B6 metabolism
ocu00760  Nicotinate and nicotinamide metabolism
ocu00830  Retinol metabolism
ocu00982  Drug metabolism - cytochrome P450
ocu01100  Metabolic pathways
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100354428 (AOX4)
   00350 Tyrosine metabolism
    100354428 (AOX4)
   00380 Tryptophan metabolism
    100354428 (AOX4)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100354428 (AOX4)
   00760 Nicotinate and nicotinamide metabolism
    100354428 (AOX4)
   00830 Retinol metabolism
    100354428 (AOX4)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100354428 (AOX4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354428 (AOX4)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100354428 (AOX4)
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DUF218
Other DBs
NCBI-GeneID: 100354428
NCBI-ProteinID: NP_001265792
Ensembl: ENSOCUG00000024593
UniProt: G1TY33
LinkDB
Position
7:141433603..141487169
AA seq 1335 aa
MPSHHNSDELIFFVNGRKVVEKHADPEVNLLQYLRKVLRLTGTKYACGGGGCGACTVMLS
RYNVKTKKIHHYPVTACLVPVCSLHGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQIMEALGGNLCRCTGYRPIVESGKTFCVESTICQVKGTG
KCCMDQEEKSSLGSQEKLCTKLYNEDEFQPLDPSQEPIFPPELIRMAEDPKKRRLTFQGE
RTTWITPVTLEDLLELRAKFPKAPLVMGNTTVGHNIKFEDKFYPVFLSPLGLPELYFVNT
TDDGVTIGAGYSLAQLNDALQFIVSEQPKERTKTFRALLSHLRTLAGAQIRNMATVGGHV
VTRPRFSDLNPILAAGNAIINLISKEGERQIPLNGPFLEGSPEADLKPEEIVLSVFIPYT
AQGHFVLGLRQAQRQENAFAIVNAGMSVKFEDGTSTIKDLQMFYGSVASTVVAAKQTCQR
LLGRSWDDQMLGDACRLVLDEIYIPPAAKGGMVEYKRTLIVSLLFKFYLKVRQGLNKMDP
KKFPDIPETYLSALEDFPIETPQGIQMFQCVDPAQPLQDPVGHPIMHQSAIKHATGEAVF
IDDMPAVDQELYLAVVTSTRAHANIISIDTSEALALPGVVDVITAEDVPGENNHKGEIFY
AKNEVICVGQIVCTVAADTYAHAKAAAKKVRIAYEDIEPRIITIKQALEHNSFLSVERKI
EQGNVEQAFKHVDQIIEGEIHVEGQEHFYMETQTVLAIPKEEDKEMVLHLGTQFPTHVQE
YVAAALNVPRSRVACHMKRAGGAFGGKVTKPALLGAVSAVAANKTGRPIRFILERGDDML
ITAGRHPLFAKYKVGFMNNGVIKAADVEYYINGGCTPDESELVTEFIVLKSENAYDIPNF
RCRGRPCKTNLPSNTAFRGFGFPQATVVVESYITAVASQCNLLPEEVKEINMYKKSSKTA
YNQKFNPEPLRRCWKDCLEKSSFHARKKAAEEFNKKNYWKKRGLAVVPMKFTIGVPIAYY
NQAAALVHIYMDGSVLLTHGGCELGQGLHTKMIQVASRELNIPKSKIHLSETSTVTVPNA
LFTAGSMGADVNGRAVQNACQILMSRLEPIIKKNPEGKWEDWVAKAFAESISLSATGYYK
GYQTNMDWEKEEGEAYPYFVYGASCAEVEVDCLTGAHKLLRTDIFMDAAFSINPAVDIGQ
VEGAFIQGMGFYTIEELKYSPEGVLYSRGPDDYKIPTVTEIPEEFYITLVHSRNPIAIYS
SKGLGEAGMFLGSAVFFAIYDAVAAARRERGLTKTFTLSSPATPELIRMTCVDQFTDMIP
RDDPSTFTPWSIHVS
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgccttcccaccacaattctgatgagctgatattttttgtgaatggaagaaaggtagta
gaaaagcatgctgatcctgaagtcaacctactgcagtacctcaggaaagtgctccgtctc
acaggcactaaatatgcctgtggaggagggggctgtggtgcctgcacagtgatgctgtca
agatacaacgtcaagaccaagaagatccaccactacccagtcacagcctgcctggtgcct
gtctgctctctgcatggggctgcggttaccacggtggaaggagtaggaagcatcaaaacc
aggattcaccccgtgcaggagagactcgccaagtgccacggcacccagtgcggattctgc
agcccaggcatggtgatgtccatctacacgctgctgaggaaccaccccgagccaacccct
gagcagataatggaagctcttggaggtaatctgtgtcgctgtactggataccgaccaatt
gtagaaagtggaaaaactttctgtgtggaatcaaccatttgtcaagtgaaaggaacagga
aaatgttgcatggatcaagaagagaagtcttctctgggcagtcaagaaaaactgtgtacc
aaactgtataatgaagatgaattccagcccttggatccatcccaggagcctatattccct
cctgaactcataagaatggcagaagacccaaagaagaggaggctgacgttccagggggag
aggaccacctggatcacccccgtgaccctggaggacctcctggagctcagagccaagttc
cccaaagcgccgctggtcatggggaacaccacggtgggacacaacattaaatttgaagat
aaattctacccagttttcctatctccactggggctcccagaactgtattttgtgaacacc
acagatgatggggtgaccattggtgcgggatacagcctggcccagctgaatgacgcctta
cagtttatcgtttcggagcaaccgaaagagaggaccaagaccttccgcgctctcctcagt
cacctgaggacgcttgcaggagcccagattaggaacatggctaccgtaggaggacacgtg
gtgacccggcctcgtttttctgacctaaatcccattttggctgcaggaaatgctatcatc
aatctgatatctaaagaaggagaacggcagattcctttgaacggccctttcctggaagga
tcgcccgaggccgacctgaaaccggaagagattgtgctgtcggttttcatcccttacact
gctcaggggcacttcgtgttggggctccggcaggctcaacggcaggagaacgcctttgcc
attgtcaatgccgggatgagtgtgaagtttgaagatggcacaagtacaatcaaggacctt
caaatgttctatggaagtgtcgcctccactgttgtggctgccaaacaaacctgccagcgg
ctccttgggaggtcatgggatgaccaaatgctgggcgacgcgtgccggttggtcctggat
gagatttacatcccgccagcagctaaggggggcatggtggaatacaagcggaccctcatc
gtcagcctgctcttcaaattctacctgaaagtgcggcaaggactaaataaaatggatcct
aagaagttccccgatattccagaaacatacctgagcgctctagaagatttccccatagaa
actccccaagggattcagatgttccagtgtgtggatcccgctcaacccttacaagatcca
gttggacacccgatcatgcaccagtcggccattaaacatgccactggagaggctgtgttt
atagatgacatgcccgccgtggaccaagaactctatcttgctgtggtcaccagcaccaga
gctcatgccaatatcatatcaattgatacttcagaagccctggcacttccaggtgtggtt
gatgtgataacagcagaagatgttccgggagaaaataaccataaaggggagattttctat
gcaaagaatgaggtaatttgcgtgggtcagatcgtctgcactgtggctgctgacacctac
gctcacgcaaaagcagcagctaaaaaagtgaggattgcttatgaagacatagagccaagg
attatcacaatcaagcaagctctggagcacaattcgttcctttctgtcgagagaaaaatt
gagcaaggcaacgtggagcaagcctttaaacacgttgaccaaatcattgaaggtgagatc
cacgtggaaggacaggaacacttttacatggaaacacaaactgtcctggctatcccaaaa
gaggaagataaagaaatggtgttacaccttgggacacagtttccaacccacgtgcaggaa
tatgtggccgcagccctaaacgtcccaaggagtagagtcgcctgtcacatgaaaagagct
ggaggagcatttggggggaaagtgaccaagcctgccctgctaggagctgtcagtgctgtg
gcggccaacaagactggccgcccaatccgatttatcctggagcgtggtgatgacatgctg
ataactgctggccgccacccactctttgcaaaatacaaagtcggattcatgaacaatggt
gtgatcaaagctgctgatgttgagtattacatcaacggtggttgcacccctgatgagtct
gagttggtgacggagttcattgtgctgaaatcagaaaatgcatatgatattcccaacttc
cggtgcagaggaagaccttgcaaaactaacttgccatccaacactgcctttcggggattt
ggcttccctcaggctacagtggtggtcgaatcttacataacggccgtggcgtctcaatgt
aacttactccctgaagaggttaaagaaataaacatgtataagaaaagcagcaaaacagcc
tacaatcagaaattcaatccagagcccttgagaagatgctggaaagactgtctggagaaa
tcttcattccacgctagaaaaaaggctgcagaggaattcaacaaaaagaattactggaag
aagagggggctggccgtcgtccctatgaagtttaccattggagtccctatagcctactac
aatcaggcagctgccctcgtccacatctacatggatggctctgtcttgctgactcacggt
ggctgtgaactgggccaaggcctgcacaccaagatgattcaggtggccagtcgagaactg
aacatacccaagtcgaaaatccacctgtcggaaacaagcactgtcacggtgcccaacgcg
ctcttcacggcggggtccatgggcgcagatgtcaatgggagagctgtgcagaatgcctgc
caaattctaatgtctcgtctcgagcccatcattaagaaaaaccctgaaggaaaatgggag
gactgggttgcaaaagcctttgcagaatccatcagtctctcagctactggatattacaag
ggctaccagacaaacatggactgggagaaggaggaaggagaagcgtatccgtattttgtc
tacggagcctcctgtgccgaggttgaagtcgactgtctgacgggggctcacaagctcctg
cggactgacatcttcatggatgctgctttcagcataaacccggccgtggacattgggcag
gttgagggtgcattcatccaaggcatgggattctataccatagaagaactgaaatactcc
ccggaaggtgtgctctattcccggggaccagatgactacaaaatccccactgtcactgag
attccagaagagttctatatcactctggtgcattcccggaaccccatagccatctactcc
tccaagggactgggtgaggccggaatgttcttaggatctgccgtgtttttcgccatatat
gatgcggtagctgctgcccgcagagaaagagggctgaccaagaccttcaccctgagcagc
ccagccactcctgaactcatccgaatgacctgtgtggatcagtttaccgacatgattccc
agagatgacccttcaacattcacaccttggtccatccatgtgtcttaa

DBGET integrated database retrieval system