KEGG   Oryctolagus cuniculus (rabbit): 100008602
Entry
100008602         CDS       T03373                                 
Symbol
IFNG
Name
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03050  Proteasome
ocu04060  Cytokine-cytokine receptor interaction
ocu04066  HIF-1 signaling pathway
ocu04217  Necroptosis
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04612  Antigen processing and presentation
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04940  Type I diabetes mellitus
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100008602 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100008602 (IFNG)
   04630 JAK-STAT signaling pathway
    100008602 (IFNG)
   04066 HIF-1 signaling pathway
    100008602 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008602 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100008602 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100008602 (IFNG)
   04612 Antigen processing and presentation
    100008602 (IFNG)
   04660 T cell receptor signaling pathway
    100008602 (IFNG)
   04658 Th1 and Th2 cell differentiation
    100008602 (IFNG)
   04659 Th17 cell differentiation
    100008602 (IFNG)
   04657 IL-17 signaling pathway
    100008602 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008602 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008602 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008602 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100008602 (IFNG)
   05164 Influenza A
    100008602 (IFNG)
   05168 Herpes simplex virus 1 infection
    100008602 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100008602 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008602 (IFNG)
   05144 Malaria
    100008602 (IFNG)
   05145 Toxoplasmosis
    100008602 (IFNG)
   05140 Leishmaniasis
    100008602 (IFNG)
   05142 Chagas disease
    100008602 (IFNG)
   05143 African trypanosomiasis
    100008602 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100008602 (IFNG)
   05323 Rheumatoid arthritis
    100008602 (IFNG)
   05321 Inflammatory bowel disease
    100008602 (IFNG)
   05330 Allograft rejection
    100008602 (IFNG)
   05332 Graft-versus-host disease
    100008602 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008602 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100008602 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ocu03051]
    100008602 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008602 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008602 (IFNG)
Proteasome [BR:ocu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100008602 (IFNG)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100008602 (IFNG)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100008602 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 100008602
NCBI-ProteinID: NP_001075460
Ensembl: ENSOCUG00000024937
UniProt: P30123 A5JW26
Structure
LinkDB
Position
4:complement(47129947..47134880), 12:complement(101894547..101895994)
AA seq 167 aa
MSYTSYILAFQLCLILGSYGCYCQDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWK
EESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTR
ISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagttatacaagttacatcttggcttttcagctctgcctcatcttgggttcttacggc
tgttactgccaggacacactaaccagagaaacagaacacctaaaggcatatttgaaagca
aatacatcagatgtggcaaatggtggaccccttttcttgaatattttgaggaattggaaa
gaggagagtgacaacaaaataattcagagccaaattgtctccttctacttcaaactcttt
gacaacttaaaagaccatgaggtcatcaagaagagtatggaatccatcaaagaagacata
tttgtgaagttcttcaatagcaacctcactaagatggatgacttccaaaatctgactcga
atttcggtggatgatcggctggtccagcgtaaagcagtaagtgaactctccaatgtgctg
aattttctgtctccaaaatccaacctaaagaagcgaaaaaggagtcagacgctgtttcga
ggtcggcgagcatccaagtactga

KEGG   Oryctolagus cuniculus (rabbit): 100008701
Entry
100008701         CDS       T03373                                 
Symbol
IL10, CSIF, IL-10
Name
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04068  FoxO signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100008701 (IL10)
   04068 FoxO signaling pathway
    100008701 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008701 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008701 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100008701 (IL10)
   04660 T cell receptor signaling pathway
    100008701 (IL10)
   04672 Intestinal immune network for IgA production
    100008701 (IL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100008701 (IL10)
   05133 Pertussis
    100008701 (IL10)
   05150 Staphylococcus aureus infection
    100008701 (IL10)
   05152 Tuberculosis
    100008701 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008701 (IL10)
   05144 Malaria
    100008701 (IL10)
   05145 Toxoplasmosis
    100008701 (IL10)
   05140 Leishmaniasis
    100008701 (IL10)
   05142 Chagas disease
    100008701 (IL10)
   05143 African trypanosomiasis
    100008701 (IL10)
  09163 Immune disease
   05310 Asthma
    100008701 (IL10)
   05322 Systemic lupus erythematosus
    100008701 (IL10)
   05320 Autoimmune thyroid disease
    100008701 (IL10)
   05321 Inflammatory bowel disease
    100008701 (IL10)
   05330 Allograft rejection
    100008701 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008701 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008701 (IL10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100008701 (IL10)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100008701 (IL10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 100008701
NCBI-ProteinID: NP_001075514
Ensembl: ENSOCUG00000014265
UniProt: Q9TVD3
LinkDB
Position
16:65583109..65589602
AA seq 178 aa
MXSSAXLCCLVFLGGTGASRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQ
LNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLR
LRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcmcagctcagcmstgctatgttgcctggtcttcctgggtgggacaggggccagccga
ggccaggacacccctgctgagaacagctgcattcactttccaggcggcctgccccacatg
ctccgcgagctccgtgctgcctttggcagggtgaagactttctttcaatcgaaggatcag
ctgaacagcatgttgttaaccgagtccctgctggaggaccttaagggttacctgggatgc
caagccttgtcggagatgatccagttttacctgaaggacgtgatgccgcaagctgagaac
cacagtccagccatcagggagcacgtgaactccctgggggaaaacctgaagaccctcagg
ctgaggctgcgacaatgtcaccgatttctcccctgtgaaaacaagagcaaggcagtggag
caggtgaagagcgccttcagcaagctgcaagaggaaggcgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaaacctacatgacaatgaagataaaaagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100008733
Entry
100008733         CDS       T03373                                 
Symbol
IL6, IL-6
Name
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01523  Antifolate resistance
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu04668  TNF signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04936  Alcoholic liver disease
ocu05010  Alzheimer disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05332  Graft-versus-host disease
ocu05410  Hypertrophic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100008733 (IL6)
   04668 TNF signaling pathway
    100008733 (IL6)
   04066 HIF-1 signaling pathway
    100008733 (IL6)
   04068 FoxO signaling pathway
    100008733 (IL6)
   04151 PI3K-Akt signaling pathway
    100008733 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008733 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008733 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100008733 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100008733 (IL6)
   04620 Toll-like receptor signaling pathway
    100008733 (IL6)
   04621 NOD-like receptor signaling pathway
    100008733 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100008733 (IL6)
   04625 C-type lectin receptor signaling pathway
    100008733 (IL6)
   04659 Th17 cell differentiation
    100008733 (IL6)
   04657 IL-17 signaling pathway
    100008733 (IL6)
   04672 Intestinal immune network for IgA production
    100008733 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008733 (IL6)
   05202 Transcriptional misregulation in cancer
    100008733 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008733 (IL6)
   05161 Hepatitis B
    100008733 (IL6)
   05171 Coronavirus disease - COVID-19
    100008733 (IL6)
   05164 Influenza A
    100008733 (IL6)
   05162 Measles
    100008733 (IL6)
   05168 Herpes simplex virus 1 infection
    100008733 (IL6)
   05163 Human cytomegalovirus infection
    100008733 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008733 (IL6)
   05169 Epstein-Barr virus infection
    100008733 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008733 (IL6)
   05135 Yersinia infection
    100008733 (IL6)
   05133 Pertussis
    100008733 (IL6)
   05134 Legionellosis
    100008733 (IL6)
   05152 Tuberculosis
    100008733 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008733 (IL6)
   05144 Malaria
    100008733 (IL6)
   05142 Chagas disease
    100008733 (IL6)
   05143 African trypanosomiasis
    100008733 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008733 (IL6)
   05321 Inflammatory bowel disease
    100008733 (IL6)
   05332 Graft-versus-host disease
    100008733 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100008733 (IL6)
   05020 Prion disease
    100008733 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100008733 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008733 (IL6)
   05410 Hypertrophic cardiomyopathy
    100008733 (IL6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100008733 (IL6)
   04932 Non-alcoholic fatty liver disease
    100008733 (IL6)
   04931 Insulin resistance
    100008733 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008733 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008733 (IL6)
   01523 Antifolate resistance
    100008733 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008733 (IL6)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100008733 (IL6)
SSDB
Motif
Pfam: IL6 IL23 DUF641 IL11 Cas_St_Csn2 UPF0147 Telomere_reg-2
Other DBs
NCBI-GeneID: 100008733
NCBI-ProteinID: NP_001075533
Ensembl: ENSOCUG00000027471
UniProt: Q9MZR1
LinkDB
Position
10:7771596..7776408
AA seq 241 aa
MNSFTSALRPGPLGCSLALLLVVATAFPTSAPVREDSNTKASPDKTLTPPGRTIESIRSI
LETIKELRKEMCDHDVNCMNRKEALAEVNLHLPRLIEEDGCFPPAVNNETCLLRITSGLM
EFRMYLEHLQAKFRSDEENTRVSMVLKNIQHLIKTLRPKVKNLNEEATLKPAVAVSLMEN
LQQKNQWLKTTTIHFILRGLTNFLEFTLRAVDLMECGCPCLRNFMGSASHGQNTPSCPLD
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaactccttcacaagcgccctccgcccaggtcccctcggctgctcgctggcgctgctc
ctggtggtggctaccgctttccccacttcagcacccgtgagggaggactccaacaccaag
gccagccccgacaaaaccctcacgccgccaggcagaaccatcgagagcatccggagcatc
ctggagaccatcaaggagctgaggaaagagatgtgtgaccatgatgtcaactgcatgaac
agaaaggaggcactggcggaagtcaatctgcaccttccaaggctgatagaagaagacgga
tgcttcccgccggcggtgaataatgagacctgcctgctgagaatcacttcggggctgatg
gagttccggatgtatctcgagcaccttcaggccaagttcaggagtgacgaagaaaacacc
agggtcagcatggtgctgaagaacatccaacacctgatcaagaccctgaggccaaaggtc
aagaatttgaatgaagaagccaccctcaagccagccgttgcggtcagcctgatggagaac
ctgcagcagaaaaaccagtggctgaagacgaccacgatccacttcatcctgcgcggcctc
acaaacttcctggagttcaccctgcgtgccgtggacctgatggagtgcgggtgtccttgc
ttgcggaatttcatgggctctgcctcccacggtcagaacacaccatcctgtccattggac
acataa

KEGG   Oryctolagus cuniculus (rabbit): 100009017
Entry
100009017         CDS       T03373                                 
Symbol
IL15
Name
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04668  TNF signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100009017 (IL15)
   04668 TNF signaling pathway
    100009017 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009017 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100009017 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009017 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009017 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009017 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009017 (IL15)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100009017 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 100009017
NCBI-ProteinID: NP_001075685
Ensembl: ENSOCUG00000008827
UniProt: Q3Y5G8
LinkDB
Position
15:complement(22773802..22866051)
AA seq 162 aa
MRISKPYLRSTSIQCYLCLLLNSHFLAEAGIHVFIFGCISAGLPKTEANWHDVISDLKRI
EDLIKSIHIDATLYTESDAHPNCKVTAMKCFLLELRVISHESRNMDINETVQNLIILANT
SLSSKGNVTESGCKECEELEEKNITEFLQSFIHIVQMFINSP
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccgtatctgagaagtacttccatccagtgctacctgtgtttactc
ctaaacagtcattttttagctgaggctggcattcatgtcttcatttttggctgtatcagt
gcaggtcttcctaaaacagaagccaactggcatgatgtcattagtgatctgaaaagaatt
gaagatcttataaaatccatccatattgatgctactttatatactgagagtgatgctcat
cccaattgcaaagtcacagcgatgaagtgctttctcctggagttacgagttatttctcat
gagtccagaaacatggacattaatgaaacagtacaaaaccttatcatcctagcaaatacc
agtttatcttctaaagggaatgtaacggaatctggttgcaaagaatgtgaggaactggag
gaaaaaaatattactgaatttttgcagagttttatacatattgtacaaatgttcatcaat
tctccttga

KEGG   Oryctolagus cuniculus (rabbit): 100302454
Entry
100302454         CDS       T03373                                 
Symbol
IL4, BSF-1, IL2
Name
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05140  Leishmaniasis
ocu05200  Pathways in cancer
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100302454 (IL4)
   04151 PI3K-Akt signaling pathway
    100302454 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302454 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100302454 (IL4)
   04660 T cell receptor signaling pathway
    100302454 (IL4)
   04658 Th1 and Th2 cell differentiation
    100302454 (IL4)
   04659 Th17 cell differentiation
    100302454 (IL4)
   04657 IL-17 signaling pathway
    100302454 (IL4)
   04664 Fc epsilon RI signaling pathway
    100302454 (IL4)
   04672 Intestinal immune network for IgA production
    100302454 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100302454 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100302454 (IL4)
  09163 Immune disease
   05310 Asthma
    100302454 (IL4)
   05320 Autoimmune thyroid disease
    100302454 (IL4)
   05321 Inflammatory bowel disease
    100302454 (IL4)
   05330 Allograft rejection
    100302454 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100302454 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100302454 (IL4)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100302454 (IL4)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100302454 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 100302454
NCBI-ProteinID: NP_001156649
Ensembl: ENSOCUG00000011943
UniProt: Q9MZR8 A5Z1F6
LinkDB
Position
3:15702780..15712347
AA seq 147 aa
MGLPAQLPVTLLCLLAGTAHFIQGRRGDIILPEVIKTLNILTERKTPCTKLMIADALAVP
KNTTEREAVCRAATALRQFYLHHKVSWCFKEHGELGDLRLLRGLDRNLCSMAKLSNCPGK
EARQTTLEDFLDRLKTAMQEKYSKRQS
NT seq 444 nt   +upstreamnt  +downstreamnt
atggggctccctgcccagctgcctgtcactctgctctgcctcctcgcaggcaccgcgcac
ttcatccaggggcgcaggggcgacatcatcctacccgaagtcatcaaaaccctgaacatc
ctcacagagagaaagactccatgcaccaagctgatgatagcagacgccctggccgtcccc
aagaacacaaccgagagagaggccgtctgcagggccgcgactgcactccggcagttctac
ctccaccacaaggtgtcttggtgcttcaaggagcacggagagctcggtgacctcagactc
ctgagaggactcgacaggaacctctgcagcatggcgaagctgagcaactgtcctgggaag
gaagccagacagactacactggaagacttcttagacaggctaaagaccgccatgcaagag
aaatactcaaagcgtcagagctga

KEGG   Oryctolagus cuniculus (rabbit): 100302458
Entry
100302458         CDS       T03373                                 
Symbol
IL2, TCGF
Name
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04151  PI3K-Akt signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100302458 (IL2)
   04151 PI3K-Akt signaling pathway
    100302458 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302458 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100302458 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100302458 (IL2)
   04660 T cell receptor signaling pathway
    100302458 (IL2)
   04658 Th1 and Th2 cell differentiation
    100302458 (IL2)
   04659 Th17 cell differentiation
    100302458 (IL2)
   04672 Intestinal immune network for IgA production
    100302458 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100302458 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100302458 (IL2)
   05171 Coronavirus disease - COVID-19
    100302458 (IL2)
   05162 Measles
    100302458 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100302458 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100302458 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100302458 (IL2)
   05321 Inflammatory bowel disease
    100302458 (IL2)
   05330 Allograft rejection
    100302458 (IL2)
   05332 Graft-versus-host disease
    100302458 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100302458 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100302458 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100302458 (IL2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100302458 (IL2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100302458 (IL2)
SSDB
Motif
Pfam: IL2 IL15
Other DBs
NCBI-GeneID: 100302458
NCBI-ProteinID: NP_001156652
Ensembl: ENSOCUG00000010100
UniProt: O77620
LinkDB
Position
15:complement(98312429..98317579)
AA seq 153 aa
MYKVQLLSCIALTLALLTSSAPTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSKLSRML
TFKFYMPKKVTELKHLQCLEEELKPLEEVLNLAQGKNSHGGNTRESISNINVTVLKLKGS
ETFMCEYDETVTIVEFLNRWITFCQSIISASSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaaagtacaactcttgtcttgcattgcactaactcttgcactccttacaagcagt
gcacctacttcaagttctacaaaggaaacacaggaacaactggatcagctactgctggat
ttacaggtgcttttgaaaggagttaatgattataagaattccaaactttccaggatgctc
acattcaaattttatatgcccaagaaggtcacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgcttaacttagctcaaggcaaaaactctcatggg
ggaaataccagagaatcaatcagcaatattaatgtaacagttctgaaactaaagggatct
gaaacattcatgtgtgaatacgatgagacagttaccattgtagaatttctgaacagatgg
atcaccttttgtcaaagcatcatctcagcatcgagttcataa

KEGG   Oryctolagus cuniculus (rabbit): 100328720
Entry
100328720         CDS       T03373                                 
Symbol
CSF2, GMCSF
Name
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu05146  Amoebiasis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05171  Coronavirus disease - COVID-19
ocu05202  Transcriptional misregulation in cancer
ocu05221  Acute myeloid leukemia
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100328720 (CSF2)
   04668 TNF signaling pathway
    100328720 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328720 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100328720 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    100328720 (CSF2)
   04660 T cell receptor signaling pathway
    100328720 (CSF2)
   04657 IL-17 signaling pathway
    100328720 (CSF2)
   04664 Fc epsilon RI signaling pathway
    100328720 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100328720 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100328720 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328720 (CSF2)
   05171 Coronavirus disease - COVID-19
    100328720 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100328720 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100328720 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100328720 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100328720 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100328720 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100328720 (CSF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     100328720 (CSF2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100328720 (CSF2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100328720 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 100328720
NCBI-ProteinID: NP_001164728
Ensembl: ENSOCUG00000003433
UniProt: B7NZK6
LinkDB
Position
3:15144158..15146030
AA seq 144 aa
MWLQNLFLLGSVVCTISAPTHQPNTVSQPLKHVDAIKEARIILSRSNDSATVLGEMVEVV
SEMFDPQKPTCLQTRLELYKQGLRGSLERLSSTLTLMASHYKQNCPPTPETSCETEFITF
KSFKENLKCFLFVIPFNCWEPVQK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggttgcagaacctgttcctcctaggcagtgtggtctgcaccatctctgcacccacc
caccagcccaacactgtcagccagcccttgaagcatgtggatgccatcaaggaggcccgg
atcatcctgagccgcagtaacgattctgccactgtgctgggcgaaatggtagaagtcgtc
tctgaaatgtttgatcctcagaaaccaacttgcctgcagacccgcctggaactgtacaag
caaggcctgcggggcagcctggagcggctctcgagtaccctgactttgatggccagccac
tacaagcaaaactgtcccccaaccccggaaacttcctgtgagaccgagtttatcaccttc
aaaagtttcaaagagaacctgaagtgctttctgtttgtcatcccctttaactgctgggag
ccagtccagaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100340820
Entry
100340820         CDS       T03373                                 
Symbol
IL9
Name
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu05310  Asthma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100340820 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340820 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100340820 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100340820 (IL9)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100340820 (IL9)
SSDB
Other DBs
NCBI-GeneID: 100340820
NCBI-ProteinID: XP_002710151
UniProt: G1SQV6
LinkDB
Position
3:complement(18397243..18400570)
AA seq 143 aa
MLLAVVLVSSLLFCSVAAQGCLTRAGVRDVDFLIHSLQDDPLSKCDCSTNVTGCLCLPIP
SDNCTTPCFQEGLSQAANSKAHAKLSLIFNRVRRTVEALKSKCPLFSCEQPCNQTTAGTT
VTFLRTLLEVFQKEARPGMTART
NT seq 432 nt   +upstreamnt  +downstreamnt
atgcttctggccgtggtccttgtctcctccctcctgttctgctccgtagcagcccagggg
tgtctgacccgggcaggggtcagggatgtggacttcctcatccacagtctacaggatgat
ccgctttcaaaatgcgactgcagcaccaacgtgaccggttgcttgtgtctgcccatcccg
tctgacaactgcaccacgccgtgtttccaggaggggctatcccaggcggccaactccaag
gcacatgcaaaactctcgctgattttcaaccgcgtgagaagaacggtggaagccttgaag
agcaagtgtccgcttttctcctgtgagcagccctgcaaccaaaccacggcgggcaccacg
gtgacgttcctgaggacgctcctggaggtcttccagaaagaagcaaggccggggatgaca
gccaggacgtga

KEGG   Oryctolagus cuniculus (rabbit): 100341420
Entry
100341420         CDS       T03373                                 
Name
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341420
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341420
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100341420
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100341420
NCBI-ProteinID: XP_002711513
Ensembl: ENSOCUG00000012894
LinkDB
Position
5:complement(657679..658987)
AA seq 203 aa
MAVSLNLMVPVLLVVVLNAARAGPVPPTKPATAGRDCRIDSFKSLSPRELEAFKTARDAL
EESLLLKSRRAPDPPRAPPPAPLLRAPPPEWERPEALEAELFMSLKVLEAMEDSARGHVL
EQPLRTLRHIHTQLRGLSPQQTASAHHPPVPKRRGRLHPLATPGSQEAPKKEAPACLEAS
VIFILFRLLTRDLKCVASGPLCV
NT seq 612 nt   +upstreamnt  +downstreamnt
atggctgtgtctctgaacctgatggtgccggtgctgctggtggtggtgctgaacgcggcc
agagcgggccccgtcccccccaccaagcccgccacagccgggagagactgccgcatcgac
agcttcaagtctctctctccacgggagctggaggccttcaagacagccagggatgccttg
gaagagtcactgttgctcaagagccgcagagccccggaccctccccgagcccctcctccc
gcgcctctcctccgcgcccctcctcctgagtgggagcgccccgaggccctggaggctgag
ctgttcatgtcgctgaaggttctggaagccatggaggactcagcccgggggcacgtcctg
gagcagcccctccgcacactgcgccacatccatacccagctgcggggcctgtctccccag
cagaccgcctcagcccaccaccccccggtccccaagcgccggggccgcctccacccactg
gctacacccggctcccaggaggcccccaagaaggaggcccccgcctgcctcgaggcctct
gtcatcttcatcctcttccgcctgctcacgcgggacctgaagtgtgtagccagtggaccc
ctgtgcgtctga

KEGG   Oryctolagus cuniculus (rabbit): 100341910
Entry
100341910         CDS       T03373                                 
Symbol
IFNE
Name
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341910 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341910 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100341910 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341910 (IFNE)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100341910 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100341910
NCBI-ProteinID: XP_017204416
UniProt: A0A7R8GV23
LinkDB
Position
1:32281221..32281793
AA seq 190 aa
MTYKYFFEIVLVLLASSTIFSLKLKRVPFQQRRMNTRSLKPWNNLQKLRIQQCLPHRNDF
RLPLKSVNPHQYQKAQVLAVIHETLQQIFSLFRENISLGGGEKNDLEKFLIELHQELQYL
EGFMELEAKQESGALGSEILRLQIKTYFLRIRDYLEAQDYSICAWIIVQVEINRCLFFVF
RLTEMLNKKS
NT seq 573 nt   +upstreamnt  +downstreamnt
atgacttacaagtacttctttgaaattgtgttggtgctgctggcctcatctactatcttc
tccctaaaactgaaacgggttcccttccaacaaagaagaatgaacacaaggagtttaaaa
ccctggaataatttacaaaagttgagaatccagcaatgtctaccacacaggaatgatttc
cggcttcccctgaagtctgtgaatcctcatcagtaccaaaaggcacaagtactggctgta
atccatgagacacttcagcagatcttcagcctcttcagagaaaatatttccctgggtggt
ggggagaaaaatgacttggagaaattcctgattgaacttcatcaagagctgcagtaccta
gaaggattcatggaactggaagcgaagcaggaaagtggagccttgggtagtgagatcctt
aggttacagattaaaacatatttcctgaggatccgtgactacctggaagcccaggactac
agtatctgtgcctggatcattgtccaggtggaaatcaaccgatgtctcttctttgtgttc
agactcacagaaatgctgaacaaaaagagctag

KEGG   Oryctolagus cuniculus (rabbit): 100342491
Entry
100342491         CDS       T03373                                 
Symbol
OSM
Name
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342491 (OSM)
   04151 PI3K-Akt signaling pathway
    100342491 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342491 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342491 (OSM)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100342491 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100342491
NCBI-ProteinID: XP_008272926
Ensembl: ENSOCUG00000010199
UniProt: U3KMW4
LinkDB
Position
Un
AA seq 247 aa
MRARLTWRSLFSVVLGLLLLSTTARCSCSRRYPELLDQLRNQADLLQNPESLLIPYIQYQ
GLEVPGPSEPCTEHPRDFPSEAALQRLSRRGFLWTLNATIDHVLPRLETMKKELFAPTDL
EQLQATANNLLGLRSNLYCMTRLLQGSSEPAKPTQSGSEPSPPPPPPPPPPPPTRSQHVF
QAKQENCRFLCGYHRFMRSARRVFSEWPHSLNPSPTHSPPEDLPKQIPGIRPSRRTKRPK
LRGKLLL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgcgggcacggctcacatggaggtcgctgttcagtgtggtccttggactcttgcttctg
agtaccacggccaggtgcagctgctcgcgccggtacccggagctcctggaccagctgcgg
aaccaggcggacctcctgcagaaccctgagagcctgctgatcccctacatccagtaccaa
ggcctggaggtgccggggccgagtgaaccctgcacggagcaccccagggacttccccagt
gaggctgccctgcagcggctgagcaggcgcggtttcctgtggaccctcaacgccacgata
gaccacgtcctgcccagactggagaccatgaagaaggaactgttcgcgcccacggacttg
gagcagctgcaggccaccgccaacaacctcctggggctcaggagcaacctctactgcatg
acccggctgcttcagggctcctcggagccggccaagcccacccagtctggctccgagccc
tcgccgccgccgccgccgccgccgccgccgccaccgcccacccgctcccagcacgtcttc
caagctaagcaggagaactgcaggttcctgtgtggctaccaccgcttcatgcgctccgcg
cgccgggtcttcagcgagtggccgcacagcctgaacccgagcccgacacacagccccccc
gaggacctgccgaagcagatccctggcatccgaccctccaggaggaccaagagaccaaag
ctcagggggaaactgctcctgtag

KEGG   Oryctolagus cuniculus (rabbit): 100342931
Entry
100342931         CDS       T03373                                 
Symbol
IFNB1
Name
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342931 (IFNB1)
   04668 TNF signaling pathway
    100342931 (IFNB1)
   04151 PI3K-Akt signaling pathway
    100342931 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342931 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100342931 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100342931 (IFNB1)
   04621 NOD-like receptor signaling pathway
    100342931 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    100342931 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    100342931 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    100342931 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100342931 (IFNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100342931 (IFNB1)
   05161 Hepatitis B
    100342931 (IFNB1)
   05160 Hepatitis C
    100342931 (IFNB1)
   05171 Coronavirus disease - COVID-19
    100342931 (IFNB1)
   05164 Influenza A
    100342931 (IFNB1)
   05162 Measles
    100342931 (IFNB1)
   05168 Herpes simplex virus 1 infection
    100342931 (IFNB1)
   05163 Human cytomegalovirus infection
    100342931 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100342931 (IFNB1)
   05169 Epstein-Barr virus infection
    100342931 (IFNB1)
   05165 Human papillomavirus infection
    100342931 (IFNB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100342931 (IFNB1)
   05152 Tuberculosis
    100342931 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100342931 (IFNB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100342931 (IFNB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100342931 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342931 (IFNB1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100342931 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead
Other DBs
NCBI-GeneID: 100342931
NCBI-ProteinID: XP_002708014
Ensembl: ENSOCUG00000021649
UniProt: G1TTX4
LinkDB
Position
1:32645865..32646407
AA seq 180 aa
MINRCILQIALLLCFSTTALSMSYNSLQIQLWHGSLTCAKLLLQLNGTTEDCLNERINFK
VPKEIKEPQQLQKEDTTLVIFEMLNNIFDIFRKNFSSTGWNETLVENLLGETHLQIHHLK
SKINKKVTLESIRMNLRLKSYYWRIMDYLETKQYSNCAWKIVQLEIFRNFSFIIMLIDYL
NT seq 543 nt   +upstreamnt  +downstreamnt
atgatcaacaggtgtatccttcaaatcgctctcctgttgtgcttctccaccacagctcta
tccatgagctacaactcgcttcagatccaactatggcacggaagtctgacgtgtgcgaag
ctcctgctccagttgaatggaacgactgaggactgcctcaatgagaggataaacttcaaa
gtccccaaggagattaaggaaccacaacagctccagaaagaagacaccaccttggttatc
tttgaaatgctcaacaacatctttgacattttcagaaaaaatttctctagcactggctgg
aatgagacccttgttgagaaccttcttggtgaaacccatttgcagattcatcatctgaag
agcaaaataaacaaaaaggtaaccttggagagcatcagaatgaatctacgcctgaagagc
tattactggaggatcatggattatctggagaccaagcagtatagcaactgtgcctggaaa
atagtccagttggaaatcttcaggaacttttcctttatcatcatgctcatagattacctc
taa

KEGG   Oryctolagus cuniculus (rabbit): 100344172
Entry
100344172         CDS       T03373                                 
Symbol
IL21
Name
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344172 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344172 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100344172 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100344172 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100344172 (IL21)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100344172 (IL21)
SSDB
Motif
Pfam: IL15 IL4
Other DBs
NCBI-GeneID: 100344172
NCBI-ProteinID: XP_008266192
Ensembl: ENSOCUG00000015304
LinkDB
Position
15:complement(98465662..98472798)
AA seq 150 aa
MERIVICLMVIFLGTVAHKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDV
QKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYS
YEKKNLKEFLERLKSLIQKMIHQHLLEHLR
NT seq 453 nt   +upstreamnt  +downstreamnt
atggaaaggatagtcatctgtctgatggtcatcttcttggggacagtggcccataaatca
agctccaaagggcaagatcgttacatgattagaatgcatcaacttttagatattgttgat
cagctgcaaagtgatgtgaatgacttggaccctgattttctacctgctccacaagatgta
cagaaaggctgtgagcagtcagctttttcatgttttcagaaggcccaactcaagccagca
aatgcaggagacaatggaaagagaataagctcattaattaaacagctgaagaggaaacta
cctagcacaaagtcaaagaaaacacagaaacacagaccaacatgtccttcgtgttattca
tatgagaaaaaaaaccttaaagaattcctagaaagactgaaatcacttattcaaaagatg
attcatcagcatctccttgaacacctgagataa

KEGG   Oryctolagus cuniculus (rabbit): 100345409
Entry
100345409         CDS       T03373                                 
Symbol
IL7
Name
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100345409 (IL7)
   04151 PI3K-Akt signaling pathway
    100345409 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100345409 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100345409 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345409 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100345409 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100345409 (IL7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100345409 (IL7)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100345409 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 100345409
NCBI-ProteinID: XP_008253909
Ensembl: ENSOCUG00000029611
LinkDB
Position
3:complement(94497308..94538927)
AA seq 169 aa
MFHVSFRYIFGIPPLILVLLPVTSSNCDIEKIKHGKEYENVLMISINELGLAEDVAHWPL
DKMIEIGSNCLNNESNFFKKHSCDDNKEADFLERAARKLDQFHDMSINEDFQNHLERVSK
GTLTLVNCTGKEEKKPLKDQKKNGRCFLKKLLQKIKTCWNKILRGIKEN
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcctttgatccttgttctgttg
ccagtgacatcatctaattgtgatattgagaaaattaaacatggcaaagaatatgagaat
gttctaatgatcagcatcaatgaattgggtttggcagaggacgttgcacattggccctta
gacaaaatgatagaaattggtagcaattgcctgaataatgaatctaacttttttaaaaaa
cattcatgtgatgataataaggaagctgattttctagaacgtgctgctcgcaagttggat
cagtttcatgatatgagtatcaatgaggatttccaaaaccacttagaaagagtatcgaag
ggcacattaacactggtgaactgcactggtaaggaagaaaagaaacctttaaaggatcag
aaaaagaatggccggtgtttcctaaagaaactactacaaaagataaaaacttgttggaat
aaaattttgaggggcattaaagaaaactga

KEGG   Oryctolagus cuniculus (rabbit): 100348954
Entry
100348954         CDS       T03373                                 
Symbol
IFNK
Name
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100348954 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348954 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100348954 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348954 (IFNK)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100348954 (IFNK)
SSDB
Motif
Pfam: Interferon DIT1_PvcA DUF3958
Other DBs
NCBI-GeneID: 100348954
NCBI-ProteinID: XP_002708089
LinkDB
Position
1:complement(26020642..26052495)
AA seq 253 aa
MYVSLDHGRKHLSKFDLFTGHDSSDEFKARPPLALVANEDTVHLDHAISTSNPLHPDMIQ
KCWWLAFLMHVFIIGFQALDCDFLNVNLNRVIRKNMKLLRNVSHSFPIECLREIKDFELP
QEILSHSQMEKRDIKEAWYEISTQAFCIFMGHAFQTTWEETHLTQIQNGLYEQVAYLEQC
LMEDIHETKEEEMKYSGTGRFLLNNLELRKYFYRMNNFLEDKKYSYCAREIVRVEITRCF
SYFYRFTAFLRRR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtacgtttcattagaccatggcaggaagcatttgtccaagtttgacctatttacaggg
catgattcttctgatgagttcaaggcccgtcctcctctggctcttgttgcaaatgaagac
accgtgcacttagaccatgcaatatcaacttctaaccctctccaccctgacatgattcaa
aagtgttggtggcttgcattccttatgcatgtgttcattatcggtttccaagctctggac
tgtgacttcttgaatgttaacctcaatagggtcatccggaaaaacatgaaacttctgaga
aatgtgagccattcatttcccatagagtgtctaagagaaatcaaagattttgagttaccc
caagagatcctatcacacagccagatggagaaaagggacatcaaggaagcctggtatgaa
atatccacacaggccttctgtatcttcatgggacatgccttccagaccacttgggaagag
acacatctgacgcaaattcaaaatggactttatgagcaagtggcatatctggaacaatgc
ctaatggaagacatacatgaaaccaaagaggaggagatgaaatactcaggcactgggcgc
ttcctgctcaacaacctggagctgaggaagtatttctacaggatgaacaatttcctggaa
gataagaaatacagttactgtgccagggagatcgtccgagtggaaatcacaagatgtttc
tcctacttttacagattcacagcatttctcaggaggagataa

KEGG   Oryctolagus cuniculus (rabbit): 100348980
Entry
100348980         CDS       T03373                                 
Symbol
IL22
Name
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100348980 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348980 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100348980 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100348980 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348980 (IL22)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100348980 (IL22)
SSDB
Motif
Pfam: IL22 IL10 Cobalamin_bind Laminin_B IL28A RNA_pol_Rpb2_7
Other DBs
NCBI-GeneID: 100348980
NCBI-ProteinID: XP_002711294
Ensembl: ENSOCUG00000001663
UniProt: G1SFV3
LinkDB
Position
4:complement(47237617..47243365)
AA seq 187 aa
MAALQKSVISFLMGTLGASGLLLMALMAHGGAALPISSHCRLDESNFTSYITNLTFMLAK
EANSADNNTDVRLIGNELFHGVNEKDHCYLLKHVLNFTLEEVLFPESDRFQPYMQQVLSF
LAKLSNNLSQCHIEGDDQHIQRNVQQLKDTVKQLGESGEIKAIGELDLLFMALRTACVSP
EQSWKMS
NT seq 564 nt   +upstreamnt  +downstreamnt
atggctgccctgcagaagtctgtgatctcgttcctgatggggactctgggagccagcggc
ctcctgctcatggccctgatggcacacggaggagctgcgctgcccatcagctcccactgc
aggctggacgagtccaacttcacttcctatatcaccaacctcaccttcatgctggctaag
gaggccaattcggcagataacaacacagatgttcgtcttattgggaatgagctgttccat
ggagtcaatgagaaagaccactgctatctgctgaagcacgtgctcaactttacccttgaa
gaagtgctgttccccgagtctgatagattccagccctacatgcagcaggtgctgtccttc
ctggccaagcttagcaacaatctcagccaatgtcatattgaaggcgatgaccagcatatc
cagcggaatgtgcagcagctgaaggacacagtgaagcagcttggagagagtggagagatc
aaagcaattggagaactggatctgctgtttatggccctgagaactgcctgcgtttcaccg
gagcaaagctggaaaatgagttaa

KEGG   Oryctolagus cuniculus (rabbit): 100349007
Entry
100349007         CDS       T03373                                 
Symbol
IL12A
Name
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04620  Toll-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04936  Alcoholic liver disease
ocu04940  Type I diabetes mellitus
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100349007 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349007 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100349007 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100349007 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100349007 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100349007 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349007 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100349007 (IL12A)
   05164 Influenza A
    100349007 (IL12A)
   05162 Measles
    100349007 (IL12A)
   05168 Herpes simplex virus 1 infection
    100349007 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100349007 (IL12A)
   05134 Legionellosis
    100349007 (IL12A)
   05152 Tuberculosis
    100349007 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100349007 (IL12A)
   05144 Malaria
    100349007 (IL12A)
   05145 Toxoplasmosis
    100349007 (IL12A)
   05140 Leishmaniasis
    100349007 (IL12A)
   05142 Chagas disease
    100349007 (IL12A)
   05143 African trypanosomiasis
    100349007 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100349007 (IL12A)
   05330 Allograft rejection
    100349007 (IL12A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100349007 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349007 (IL12A)
   04936 Alcoholic liver disease
    100349007 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100349007 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100349007 (IL12A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100349007 (IL12A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100349007 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 100349007
NCBI-ProteinID: XP_008264631
Ensembl: ENSOCUG00000010149
UniProt: A0A5F9CIX7
LinkDB
Position
14:54457698..54464573
AA seq 219 aa
MCSLRGLLLVSTLVLLNGLSLARNLPVATPDLGLFQCLNHSQNLLRAVSDTLHKARQTLE
FYSCTSEEIDHEDITKDKTSTVKACLPLELTKNESCLASRETSLIINGSCLSSGKTSSMV
TLCLSSIYEDLKMYQVEFMAMNAKLLMDSKRQIFLDQDMLGAIEELMQALNSNSGAVPQN
PSLEELDFYKTKIKLCILLHAFRIRVVTIDRMMSYLSSS
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtgctccctgcgcggcctcctccttgtgtccacgcttgtccttctgaacggcctcagt
ctggccaggaacctgcccgtggccacaccggacctgggactattccagtgccttaaccac
tcccaaaacctgctgagagccgtcagcgacacgctacacaaggccagacaaactctagaa
ttctactcctgcacttctgaggagattgatcatgaagatatcacaaaagataagaccagc
acggtgaaggcctgtttaccactggagttaaccaagaatgagagttgcctggcttccaga
gagacctctttaataattaatgggagttgcctgtcttctggaaagacctcctctatggtg
accctgtgccttagtagtatctatgaggacttgaagatgtaccaggtagagttcatggcc
atgaatgcaaagcttctgatggattctaagagacagatctttctagatcaagacatgctg
ggagctattgaagagctgatgcaggccttgaattccaacagtggagctgtgccacaaaac
ccctcccttgaagagctggatttctataaaacaaaaatcaaactctgcattcttctgcat
gctttcagaattcgtgtggtgactattgatagaatgatgagctatctgagttcttcctga

KEGG   Oryctolagus cuniculus (rabbit): 100352065
Entry
100352065         CDS       T03373                                 
Symbol
IL23A
Name
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04659  Th17 cell differentiation
ocu05133  Pertussis
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100352065 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352065 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100352065 (IL23A)
   04659 Th17 cell differentiation
    100352065 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352065 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100352065 (IL23A)
   05152 Tuberculosis
    100352065 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100352065 (IL23A)
   05321 Inflammatory bowel disease
    100352065 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100352065 (IL23A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100352065 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 100352065
NCBI-ProteinID: XP_002711125
Ensembl: ENSOCUG00000007233
UniProt: G1SSM0
LinkDB
Position
4:39913110..39916509
AA seq 191 aa
MLGLKAGLLLLLLLWTAQGRAVPGDSSPAWTQCQQLSQKLCTLAWSAHPQMGPMELLREE
GDEETTSDDVPHIQCEDGCDPQGLRDNTQFCLQRIRQGLFFYEKLLGSDIFTGEPALLPD
GPVGQLHASLLGLSQLLQPEGHHRETPQTPSLHPSQPWQRRLLRFKILRSLQAFLAVAAR
VFAHGAATLSP
NT seq 576 nt   +upstreamnt  +downstreamnt
atgctggggctcaaagctgggttgctgctgttgctgctgctctggactgctcagggccgg
gctgtgcctggggacagcagccccgcctggactcagtgccagcagctctcccagaagctc
tgcacactggcctggagtgcacatccccagatgggacccatggagctactaagagaagag
ggagatgaagagactaccagtgacgatgtcccccatatccagtgtgaagatggctgtgac
ccccagggactaagggacaacactcagttctgcctgcagaggatccgccagggtttgttt
ttttacgagaagctgttgggctcagacattttcacaggggagccggctctcctccctgac
ggccctgtgggtcagcttcacgcctctctcctgggcctcagccaactcctgcagcccgag
ggtcaccaccgggagactccgcagaccccgagcctccatcccagccagccatggcagcgc
cgcctcctccgcttcaagatccttcgcagcctccaggcctttttggccgtggctgcccga
gtctttgcccatggagcggcaactctgagcccctaa

KEGG   Oryctolagus cuniculus (rabbit): 100353137
Entry
100353137         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353137
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353137
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100353137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353137
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353137
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100353137
NCBI-ProteinID: XP_002708101
Ensembl: ENSOCUG00000021343
UniProt: G1SMG6
LinkDB
Position
1:complement(32312473..32313117)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaccaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggaaatcaggagagccttctcctcgacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100353390
Entry
100353390         CDS       T03373                                 
Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353390
   04151 PI3K-Akt signaling pathway
    100353390
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353390
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100353390
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100353390
   04621 NOD-like receptor signaling pathway
    100353390
   04622 RIG-I-like receptor signaling pathway
    100353390
   04623 Cytosolic DNA-sensing pathway
    100353390
   04650 Natural killer cell mediated cytotoxicity
    100353390
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353390
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100353390
   05161 Hepatitis B
    100353390
   05160 Hepatitis C
    100353390
   05171 Coronavirus disease - COVID-19
    100353390
   05164 Influenza A
    100353390
   05162 Measles
    100353390
   05168 Herpes simplex virus 1 infection
    100353390
   05163 Human cytomegalovirus infection
    100353390
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353390
   05169 Epstein-Barr virus infection
    100353390
   05165 Human papillomavirus infection
    100353390
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100353390
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100353390
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100353390
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100353390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353390
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353390
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100353390
NCBI-ProteinID: XP_002708102
UniProt: A0A7R8C371
LinkDB
Position
1:32321773..32322342
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcagaggaaatgcctctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100353640
Entry
100353640         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353640
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353640
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100353640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353640
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353640
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100353640
NCBI-ProteinID: XP_002708103
Ensembl: ENSOCUG00000022254
UniProt: G1U4J3
LinkDB
Position
1:complement(32334573..32335503)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccgctgagcaggacgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcccttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100353705
Entry
100353705         CDS       T03373                                 
Symbol
IL20
Name
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353705 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353705 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100353705 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353705 (IL20)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100353705 (IL20)
SSDB
Motif
Pfam: IL10 DUF1922 DASH_Dad3 MitMem_reg
Other DBs
NCBI-GeneID: 100353705
NCBI-ProteinID: XP_002717482
Ensembl: ENSOCUG00000014282
UniProt: G1T734
LinkDB
Position
16:complement(65501125..65504370)
AA seq 187 aa
MRAAGLALGFLCAVFHLLWAPSTGLRTLQLGSCVVTTDLQEIQSVFSELRHSVQAKDDIT
DIRILRRTESLQDTKPKGRCCLLRRLLRLYMERVFNNYPAPDHQTLRKISRLANSLLTIK
KDLRLCHANKKCHCGKEAMEKYNQILRQFEQLEPQAAVVKALGELDILLQWMEETVMDGG
DSEAERH
NT seq 564 nt   +upstreamnt  +downstreamnt
atgagagccgcgggacttgccttgggctttctctgtgctgtgttccatctcctctgggct
ccttccacggggctcaggacactgcaactgggaagctgtgtggtcaccacagacctccag
gagatacagagtgtattttctgagcttcggcacagcgtgcaggccaaagatgacatcact
gacatcagaatcttaaggaggacggagtctttgcaggacacaaagcccaagggccgatgc
tgtctcctccgccgtttgctgagactctatatggagagagtgttcaataactacccggcc
cctgaccatcagaccctccggaagatcagcaggctcgccaactcccttctcaccatcaag
aaggaccttcggctctgccatgccaacaaaaaatgccattgtgggaaggaagcaatggag
aaatacaatcagattctgcgtcagttcgaacagctggagccccaggcagccgtcgtgaag
gccctgggggaactggacatcctgctgcagtggatggaggagacagtgatggacggagga
gacagtgaagcagagaggcactga

KEGG   Oryctolagus cuniculus (rabbit): 100353888
Entry
100353888         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353888
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353888
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100353888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353888
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100353888
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100353888
NCBI-ProteinID: XP_002708104
Ensembl: ENSOCUG00000028068
UniProt: G1SMG6
LinkDB
Position
1:complement(32348955..32349566)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaccaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacagctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcgacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100353950
Entry
100353950         CDS       T03373                                 
Symbol
IL19
Name
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353950 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353950 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100353950 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353950 (IL19)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100353950 (IL19)
SSDB
Motif
Pfam: IL10 Cas5fv_helical
Other DBs
NCBI-GeneID: 100353950
NCBI-ProteinID: XP_002717483
Ensembl: ENSOCUG00000014272
LinkDB
Position
16:complement(65519479..65525709)
AA seq 177 aa
MKVQGVPLWLLGITFVLCSGHLRGLRRCPISMDMRHLQESFQDIQRAIQANDTFQNITIL
SALDSLQGIKPLDVCCVTRSLLAFYMDRVFKDHQEPDPHILRRISSIANSFLYMQKTVQQ
CQVQGRCHCREEATNVTQIIHNNYNQLEARVAAVKSLGELNVFLAWISENYQDGSAA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaggtgcagggtgtccccctctggctcctgggcatcacgtttgtcctgtgctcaggg
cacctccgtggtctcaggagatgtccgatctccatggacatgcgccacctgcaagagagt
ttccaagacatccaaagagccatacaagccaatgacaccttccaaaacatcaccatcctg
tctgcactggacagcctgcagggcattaagccgttagatgtgtgctgcgtgaccaggagc
ctcctggcgttctacatggacagggtgttcaaggaccaccaggagccggacccgcacatc
ttgaggcgaatcagcagcattgccaactccttcctctacatgcagaagaccgtgcagcag
tgtcaggtgcagggacggtgtcactgcagggaggaagccaccaacgtgacccaaatcatt
cacaacaactataatcagttggaggcccgcgtggctgccgtcaagtccttgggagagctc
aatgtctttctggcctggatcagcgagaattaccaagacggctctgctgcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354397
Entry
100354397         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354397
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354397
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100354397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354397
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354397
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100354397
NCBI-ProteinID: XP_002708105
Ensembl: ENSOCUG00000021714
UniProt: G1SHV2
LinkDB
Position
1:complement(32363360..32363995)
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKHQAVSVLHEMLQQIFNLLHTAHSSAAWNNTLLEELNAALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaccaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagcaccaggccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcactcctctgctgcctgg
aacaacaccctcctggaggaactgaatgctgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354643
Entry
100354643         CDS       T03373                                 
Symbol
CTF1
Name
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354643 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354643 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354643 (CTF1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100354643 (CTF1)
SSDB
Motif
Pfam: CNTF NolB LIF_OSM PRF
Other DBs
NCBI-GeneID: 100354643
NCBI-ProteinID: XP_008246936
LinkDB
Position
Un
AA seq 199 aa
MSRREGSLEDPQAASSVPGLPHLEAKIRQTHSLARLLTKYAEQLLQEYVQHQGDPFGLPG
FSPPRLPVAGLSAPAPSLRGAAGAERLQLDAAALAGLPPLLDAVRRRQAELNPRAPRLLR
RLEDAARQVRALGAAVETVLAALGAADPGPRPEPPATAAAAAAGTFQAKVLGLRVCGLCR
EWVSRTEGDLGPLLPGGPA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagatccccaggctgcctcctcagtcccgggtctt
ccccacttggaggccaagatccggcagacacacagcctagcccgcctcctcaccaaatac
gcggagcagctgctccaggaatatgtgcagcatcagggcgaccccttcgggctgccgggc
ttctcgccaccgcggctgcccgtggccggcctgagcgccccggccccgagcctacgaggg
gctgccggagccgagcggctgcagctggacgcggcggcgctcgcggggctgcccccgctg
ttggacgccgtgcgccgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgg
cgcctggaggacgcggcgcgccaggtccgggccctgggcgccgccgtggagaccgtgctg
gcggcgctgggtgccgccgacccggggccccggccggagccgcccgccaccgccgccgcc
gccgccgcgggcaccttccaggccaaggtgctggggctccgcgtgtgcggcctctgccgc
gagtgggtgagccgcaccgagggcgacctgggcccgctgctgcccggcggcccggcctga

KEGG   Oryctolagus cuniculus (rabbit): 100354654
Entry
100354654         CDS       T03373                                 
Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354654
   04151 PI3K-Akt signaling pathway
    100354654
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354654
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100354654
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354654
   04621 NOD-like receptor signaling pathway
    100354654
   04622 RIG-I-like receptor signaling pathway
    100354654
   04623 Cytosolic DNA-sensing pathway
    100354654
   04650 Natural killer cell mediated cytotoxicity
    100354654
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354654
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100354654
   05161 Hepatitis B
    100354654
   05160 Hepatitis C
    100354654
   05171 Coronavirus disease - COVID-19
    100354654
   05164 Influenza A
    100354654
   05162 Measles
    100354654
   05168 Herpes simplex virus 1 infection
    100354654
   05163 Human cytomegalovirus infection
    100354654
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354654
   05169 Epstein-Barr virus infection
    100354654
   05165 Human papillomavirus infection
    100354654
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100354654
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100354654
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100354654
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100354654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354654
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354654
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100354654
NCBI-ProteinID: XP_002708106
Ensembl: ENSOCUG00000027561
UniProt: G1TKA0
LinkDB
Position
1:complement(32373937..32374506)
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLNDRRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKKYSPCAWEVVRAEARRAVSLSRI
WQERLWRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcaatgacaggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctttcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
catgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactctgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagattatggcgcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100354852
Entry
100354852         CDS       T03373                                 
Symbol
IL12B
Name
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04620  Toll-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04936  Alcoholic liver disease
ocu04940  Type I diabetes mellitus
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354852 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354852 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100354852 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100354852 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100354852 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100354852 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354852 (IL12B)
   05205 Proteoglycans in cancer
    100354852 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100354852 (IL12B)
   05164 Influenza A
    100354852 (IL12B)
   05162 Measles
    100354852 (IL12B)
   05168 Herpes simplex virus 1 infection
    100354852 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100354852 (IL12B)
   05134 Legionellosis
    100354852 (IL12B)
   05152 Tuberculosis
    100354852 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100354852 (IL12B)
   05145 Toxoplasmosis
    100354852 (IL12B)
   05140 Leishmaniasis
    100354852 (IL12B)
   05142 Chagas disease
    100354852 (IL12B)
   05143 African trypanosomiasis
    100354852 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100354852 (IL12B)
   05330 Allograft rejection
    100354852 (IL12B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100354852 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100354852 (IL12B)
   04936 Alcoholic liver disease
    100354852 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354852 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100354852 (IL12B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100354852 (IL12B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100354852 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 fn3 Ig_4 Ig_2 Tissue_fac ig I-set
Other DBs
NCBI-GeneID: 100354852
NCBI-ProteinID: XP_002710393
Ensembl: ENSOCUG00000016322
UniProt: G1TBD7
LinkDB
Position
3:complement(40709807..40721669)
AA seq 324 aa
MCHWQLVTFWFALVLLASPLVAIWELEKDVYVVELDWYPDAPGETVVLTCDTSEEDGITW
TSEQSNKVLGSGKTLTILVKEFGDAGQYTCHKGDKVLGHSKVLLHKKEDGIWSTDILKDQ
KEPKSKTFLKCEAKNYSGHFTCWWLTAISRDVKFSVKSNRGSSDPQGVTCGVPERVSVNH
TEYKYSVECQEDNACPAAEESLHLEVMLDAIHKLKYENYTSSFFIRDIIKPDPPQNLQMK
PLKNSRHVEVSWEYPDTWSTPHSYFSLTFCVQVQNKNKKEKKDRLCVDKTSATVMCHKDA
KIRVQARDRYYSSSWSEWAFVSCN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtgtcattggcagttggtcaccttctggtttgccctggtcttgctggcatctcccctc
gtggccatatgggaactggagaaagatgtttatgttgtagagttagattggtaccctgat
gccccaggagaaacagtggtcctcacctgcgacacctccgaagaagatggcattacctgg
acttcagaacagagcaataaggtcttaggatctggcaaaaccctgaccatcctagtcaaa
gagtttggagatgctggccaatacacctgccacaaaggagacaaggttctgggccattca
aaagtgttgcttcacaaaaaggaagatggaatttggtctactgatattttgaaggaccag
aaagaacctaaaagtaagacctttctaaaatgcgaggcaaagaattattctggacatttc
acctgttggtggctgacggcaatcagtagggacgtgaaattcagtgtcaaaagcaacaga
ggctcttctgacccccaaggagtgacatgtggagtaccagagagagtcagtgtgaaccac
acggagtataagtactcagtggagtgtcaggaagacaatgcctgtcctgctgctgaagag
agcctgcaccttgaggtgatgctggatgctattcacaagctcaaatatgaaaactacacc
agcagcttcttcatcagagacatcatcaaacctgatccaccccaaaacctgcagatgaag
ccattgaagaattcccggcatgtggaggtcagctgggagtaccctgatacctggagtacc
ccacactcatacttctccctgacattctgtgttcaggtgcagaacaagaacaagaaagaa
aagaaagatagactctgtgtggacaagacttcggccacagtcatgtgccacaaggatgcc
aagattcgtgtgcaagcccgggaccgctactatagctcatcttggagcgaatgggcattt
gtgtcctgcaattag

KEGG   Oryctolagus cuniculus (rabbit): 100354910
Entry
100354910         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354910
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354910
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100354910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354910
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100354910
SSDB
Motif
Pfam: Interferon DIRP GAT
Other DBs
NCBI-GeneID: 100354910
NCBI-ProteinID: XP_002708107
Ensembl: ENSOCUG00000021872
UniProt: A0A7R8C3N5
LinkDB
Position
1:32419582..32420169
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRKTLVLLGQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQAVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggctcagctgctccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccactgagcaggaagaccttggtgctt
ctgggccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggaagccagttccagaagaaccaggccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctcctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcccttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaaca
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100355421
Entry
100355421         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355421
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355421
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100355421
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355421
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355421
SSDB
Motif
Pfam: Interferon DIRP GAT
Other DBs
NCBI-GeneID: 100355421
NCBI-ProteinID: XP_002708109
Ensembl: ENSOCUG00000023654
UniProt: G1SI24
LinkDB
Position
1:32438918..32439505
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSAPLSRKTLVLLGQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgcccctctgagcaggaagaccttggtgctt
ctgggccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctcctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcccttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcgacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100355669
Entry
100355669         CDS       T03373                                 
Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355669
   04151 PI3K-Akt signaling pathway
    100355669
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355669
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100355669
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355669
   04621 NOD-like receptor signaling pathway
    100355669
   04622 RIG-I-like receptor signaling pathway
    100355669
   04623 Cytosolic DNA-sensing pathway
    100355669
   04650 Natural killer cell mediated cytotoxicity
    100355669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355669
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355669
   05161 Hepatitis B
    100355669
   05160 Hepatitis C
    100355669
   05171 Coronavirus disease - COVID-19
    100355669
   05164 Influenza A
    100355669
   05162 Measles
    100355669
   05168 Herpes simplex virus 1 infection
    100355669
   05163 Human cytomegalovirus infection
    100355669
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355669
   05169 Epstein-Barr virus infection
    100355669
   05165 Human papillomavirus infection
    100355669
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355669
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355669
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100355669
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100355669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355669
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355669
SSDB
Motif
Pfam: Interferon CoV_NSP2_N
Other DBs
NCBI-GeneID: 100355669
NCBI-ProteinID: XP_002708110
Ensembl: ENSOCUG00000022979
UniProt: A0A7R8GV21
LinkDB
Position
1:32429857..32430426
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSSMLLGQMRRVSPLACLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEETPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctcttgcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagacacccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcggaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100355912
Entry
100355912         CDS       T03373                                 
Name
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100355912
   04151 PI3K-Akt signaling pathway
    100355912
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355912
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100355912
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355912
   04621 NOD-like receptor signaling pathway
    100355912
   04622 RIG-I-like receptor signaling pathway
    100355912
   04623 Cytosolic DNA-sensing pathway
    100355912
   04650 Natural killer cell mediated cytotoxicity
    100355912
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355912
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355912
   05161 Hepatitis B
    100355912
   05160 Hepatitis C
    100355912
   05171 Coronavirus disease - COVID-19
    100355912
   05164 Influenza A
    100355912
   05162 Measles
    100355912
   05168 Herpes simplex virus 1 infection
    100355912
   05163 Human cytomegalovirus infection
    100355912
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355912
   05169 Epstein-Barr virus infection
    100355912
   05165 Human papillomavirus infection
    100355912
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100355912
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355912
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100355912
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100355912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355912
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100355912
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100355912
NCBI-ProteinID: XP_002708111
Ensembl: ENSOCUG00000021123
UniProt: A0A7R8GV81
LinkDB
Position
1:32456449..32457018
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDRRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
LQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacaggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
ttgcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356419
Entry
100356419         CDS       T03373                                 
Name
(RefSeq) interferon alpha-14-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356419
   04151 PI3K-Akt signaling pathway
    100356419
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356419
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356419
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356419
   04621 NOD-like receptor signaling pathway
    100356419
   04622 RIG-I-like receptor signaling pathway
    100356419
   04623 Cytosolic DNA-sensing pathway
    100356419
   04650 Natural killer cell mediated cytotoxicity
    100356419
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356419
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356419
   05161 Hepatitis B
    100356419
   05160 Hepatitis C
    100356419
   05171 Coronavirus disease - COVID-19
    100356419
   05164 Influenza A
    100356419
   05162 Measles
    100356419
   05168 Herpes simplex virus 1 infection
    100356419
   05163 Human cytomegalovirus infection
    100356419
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356419
   05169 Epstein-Barr virus infection
    100356419
   05165 Human papillomavirus infection
    100356419
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356419
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356419
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100356419
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100356419
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356419
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356419
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100356419
NCBI-ProteinID: XP_002708112
UniProt: A0A7R8GUW1
LinkDB
Position
1:32486219..32486788
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLLQTHSLNDGRSSMLLGQMRRVSPLSCLQDRHDFE
CPLEELGGHQAQRTQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
LQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcttcagacccacagcctcaatgacgggaggtcctccatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
tgccccctggaggagttgggtggacaccaggcccagaggacacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcgtctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
ttgcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100356678
Entry
100356678         CDS       T03373                                 
Name
(RefSeq) interferon alpha-1/13-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356678
   04151 PI3K-Akt signaling pathway
    100356678
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356678
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100356678
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356678
   04621 NOD-like receptor signaling pathway
    100356678
   04622 RIG-I-like receptor signaling pathway
    100356678
   04623 Cytosolic DNA-sensing pathway
    100356678
   04650 Natural killer cell mediated cytotoxicity
    100356678
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356678
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100356678
   05161 Hepatitis B
    100356678
   05160 Hepatitis C
    100356678
   05171 Coronavirus disease - COVID-19
    100356678
   05164 Influenza A
    100356678
   05162 Measles
    100356678
   05168 Herpes simplex virus 1 infection
    100356678
   05163 Human cytomegalovirus infection
    100356678
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356678
   05169 Epstein-Barr virus infection
    100356678
   05165 Human papillomavirus infection
    100356678
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356678
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356678
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100356678
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100356678
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356678
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356678
SSDB
Motif
Pfam: Interferon Ku_C DUF6559
Other DBs
NCBI-GeneID: 100356678
NCBI-ProteinID: XP_002708113
UniProt: A0A7R8GUY5
LinkDB
Position
1:32506224..32506793
AA seq 189 aa
MASAFCLVLVLVVFNCMSVCALNCDLPQTHSQNNKETFKKLREMRKVMGFFCMQYIHDFG
LPREELEGHQVQKAQTIAVLHEVTQGVFTLFCAPDSSATWNNTILDILCSRLHQQLSDLE
ACVKQEVEVKQTPTIQNPSVRAVNKYFRNIRLYLTEKEDSPCAWMTVTLEVSRAMSLSRF
LQERLRSKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcggcattttgtcttgtgctggtgctggtagtattcaactgtatgtctgtctgt
gctctgaattgtgatctacctcagactcacagccagaataacaaagaaactttcaagaag
ctgagagaaatgaggaaagtgatgggcttcttctgcatgcagtacattcacgattttggg
ttaccacgggaggagcttgaaggacaccaggtccagaaggctcaaactattgctgtgctg
catgaggtgacccagggggtcttcacacttttctgcgcaccggactcatctgctacctgg
aacaataccatcctggacatactgtgctctagactccaccagcagctgagtgacctggaa
gcctgtgtgaagcaagaagtggaggtgaaacagacacccacgatacagaatccctctgta
cgagctgtgaataagtacttcagaaatatccgcctctatctgacagagaaggaagacagc
ccttgtgcctggatgactgtcacactagaagtttcgagagccatgtctttatcaagattc
ttgcaagaaagattaagaagtaaggattga

KEGG   Oryctolagus cuniculus (rabbit): 100356937
Entry
100356937         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100356937
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356937
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100356937
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356937
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100356937
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100356937
NCBI-ProteinID: XP_002708114
UniProt: A0A5F9DR29
LinkDB
Position
1:32526008..32526942
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTAHSSAAWNNILLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccgctgagcaggacgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcactcctctgctgcctgg
aacaacatcctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacggctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100357194
Entry
100357194         CDS       T03373                                 
Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357194
   04151 PI3K-Akt signaling pathway
    100357194
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357194
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100357194
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357194
   04621 NOD-like receptor signaling pathway
    100357194
   04622 RIG-I-like receptor signaling pathway
    100357194
   04623 Cytosolic DNA-sensing pathway
    100357194
   04650 Natural killer cell mediated cytotoxicity
    100357194
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357194
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357194
   05161 Hepatitis B
    100357194
   05160 Hepatitis C
    100357194
   05171 Coronavirus disease - COVID-19
    100357194
   05164 Influenza A
    100357194
   05162 Measles
    100357194
   05168 Herpes simplex virus 1 infection
    100357194
   05163 Human cytomegalovirus infection
    100357194
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357194
   05169 Epstein-Barr virus infection
    100357194
   05165 Human papillomavirus infection
    100357194
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100357194
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100357194
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100357194
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100357194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357194
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357194
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100357194
NCBI-ProteinID: XP_002708115
Ensembl: ENSOCUG00000022525
UniProt: G1TMS3
LinkDB
Position
1:32518268..32518840
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIAVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcctttctcttcactgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcccctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgctgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100357452
Entry
100357452         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357452
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357452
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100357452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357452
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357452
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100357452
NCBI-ProteinID: XP_002708116
UniProt: A0A7R8C502
LinkDB
Position
1:32544951..32545862
AA seq 195 aa
MAQLLPLLTALVLCSYGLVGSLGCDLPHNSAPLSRSTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccttgttgga
tctctgggctgtgacctgccccacaactctgcccctctgagcaggtcgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctgctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacagctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100357708
Entry
100357708         CDS       T03373                                 
Name
(RefSeq) interferon alpha-21-like
  KO
K05414  interferon alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04936  Alcoholic liver disease
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357708
   04151 PI3K-Akt signaling pathway
    100357708
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100357708
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100357708
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100357708
   04621 NOD-like receptor signaling pathway
    100357708
   04622 RIG-I-like receptor signaling pathway
    100357708
   04623 Cytosolic DNA-sensing pathway
    100357708
   04650 Natural killer cell mediated cytotoxicity
    100357708
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357708
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357708
   05161 Hepatitis B
    100357708
   05160 Hepatitis C
    100357708
   05171 Coronavirus disease - COVID-19
    100357708
   05164 Influenza A
    100357708
   05162 Measles
    100357708
   05168 Herpes simplex virus 1 infection
    100357708
   05163 Human cytomegalovirus infection
    100357708
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357708
   05169 Epstein-Barr virus infection
    100357708
   05165 Human papillomavirus infection
    100357708
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100357708
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100357708
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100357708
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100357708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100357708
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100357708
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100357708
NCBI-ProteinID: XP_002708117
Ensembl: ENSOCUG00000020925
UniProt: G1SHR2
LinkDB
Position
1:complement(32565818..32566387)
AA seq 189 aa
MALPFSSLLALLVLSSKSLCSLGCDLPQTHSLSDGRSFMLLGQMRRVSPLSCLQDRHDFE
FPLEELGGHQAQRAQAISVLHEMTQQLLNLFSTKEASAAWDKALLDRLCTGLFEQQSDLE
VCMMQGAGAEEMPLKHEDSAWAVRKYFQGIVVYLAEKQYSPCAWEVVRAEARRAVSLSRI
WQERIWSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgcccttctcttcgctgctggccctgctggtgctcagctccaagtccctctgc
tctctgggctgtgatctgcctcagacccacagcctcagtgacgggaggtccttcatgctc
ctgggacaaatgaggagagtctcccctctctcctgcttgcaggacagacatgactttgag
ttccccctggaggagttgggtggacaccaggcccagagggcacaggccatctctgtgctc
cacgagatgacccagcagctcctcaacctgttcagcaccaaggaggcatctgctgcctgg
gacaaggccctcctggacagactctgcactggactcttcgagcagcagagtgacctggag
gtctgcatgatgcagggagcgggggcggaggagatgcctctgaagcatgaggactccgca
tgggctgtgaggaaatacttccaaggaattgttgtctatctggcagagaagcaatacagc
ccttgtgcctgggaggttgtcagagcagaagccaggagagccgtctctttatcaagaatc
tggcaagaaagaatttggagcaaggaatga

KEGG   Oryctolagus cuniculus (rabbit): 100358075
Entry
100358075         CDS       T03373                                 
Symbol
IL5
Name
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05200  Pathways in cancer
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358075 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358075 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100358075 (IL5)
   04660 T cell receptor signaling pathway
    100358075 (IL5)
   04658 Th1 and Th2 cell differentiation
    100358075 (IL5)
   04657 IL-17 signaling pathway
    100358075 (IL5)
   04664 Fc epsilon RI signaling pathway
    100358075 (IL5)
   04672 Intestinal immune network for IgA production
    100358075 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358075 (IL5)
  09163 Immune disease
   05310 Asthma
    100358075 (IL5)
   05320 Autoimmune thyroid disease
    100358075 (IL5)
   05321 Inflammatory bowel disease
    100358075 (IL5)
   05330 Allograft rejection
    100358075 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358075 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100358075 (IL5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100358075 (IL5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100358075 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 100358075
NCBI-ProteinID: XP_002710247
Ensembl: ENSOCUG00000004171
UniProt: G1SL79
LinkDB
Position
3:complement(15573493..15576133)
AA seq 134 aa
MRMLLHWTLLALGAAYVCAMATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNH
HLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQ
EFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcactggaccttgctggctcttggagctgcctatgtttgtgccatg
gccacagaaatccgcatgagcacagtggtgaaagagaccctgacactgctctcaacttac
cagagtctgctgataggcaatgagactttgatgattcctgttccggtccataaaaatcat
cacctatgcatcgaagaaacctttcgaggtgtagacacactgaaggctcagattgtgcaa
ggggaggctatggacaatctgttccaaaacttgtatttaataaaaaaatacattgaccta
caaaaaaaaaagtgtggtgaagaaaggcggggagttaagcacttcctagactacctgcag
gagttccttggtgtgataaacactgagtggacgatggaaagctga

KEGG   Oryctolagus cuniculus (rabbit): 100358223
Entry
100358223         CDS       T03373                                 
Name
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358223
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358223
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100358223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358223
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100358223
SSDB
Motif
Pfam: Interferon GAT
Other DBs
NCBI-GeneID: 100358223
NCBI-ProteinID: XP_002708119
Ensembl: ENSOCUG00000023921
UniProt: G1U4J3
LinkDB
Position
1:32573601..32574280
AA seq 195 aa
MAQLLPLLTALVLCSYGPVGSLGCDLPHNSVPLSRTTLVLLDQMRRVSPVLCLKDRRDFQ
FPREVVNGSQFQKNQTVSVLHEMLQQIFNLLHTARSSAAWNNTLLEELHTALHQQLQGLE
TCLVQAMGEEDSVLTADSPTLMLKRYFQRIRLYLDEKKHSGCAWELVRMEIRRAFSSTAD
LQESLRSKDGDLASS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcccagctactccctctgctgacggccctggtgctgtgcagctatggccctgttgga
tctctgggctgtgacctgcctcacaactctgtcccgctgagcaggacgaccttggtgctt
ctggaccagatgaggagggtctcccctgtcttgtgtctcaaggacagaagagacttccag
ttcccgcgggaggtggtgaacggcagccagttccagaagaaccagaccgtgtctgtcctg
cacgagatgctgcagcagatcttcaacctcctccacacagcgcgctcctctgctgcctgg
aacaacaccctcctggaggaactgcacactgcacttcatcagcagctgcaaggcctggag
acctgcttggtacaggccatgggagaggaagactctgtcctgacagctgacagcccaacg
ctgatgctgaagaggtacttccagagaatccgtctctacctggacgagaagaaacacagt
ggctgtgcctgggaactcgtcagaatggagatcaggagagccttctcctcaacagcagac
ttgcaggaaagcttaagaagcaaggatggagacctggcgtcatcctga

KEGG   Oryctolagus cuniculus (rabbit): 100358676
Entry
100358676         CDS       T03373                                 
Symbol
IL13
Name
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04664  Fc epsilon RI signaling pathway
ocu05200  Pathways in cancer
ocu05310  Asthma
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358676 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358676 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100358676 (IL13)
   04657 IL-17 signaling pathway
    100358676 (IL13)
   04664 Fc epsilon RI signaling pathway
    100358676 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358676 (IL13)
  09163 Immune disease
   05310 Asthma
    100358676 (IL13)
   05321 Inflammatory bowel disease
    100358676 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358676 (IL13)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100358676 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 100358676
NCBI-ProteinID: XP_002710138
LinkDB
Position
3:15690254..15692738
AA seq 187 aa
MSKDVVYRYVCQRRPGCWGVTTRAYKSCHRRPGPQSLSWASPHACSRSSSAALGSMALWW
AVAIAVTCLGSLVSPGPVPPPTSLKELIEELVNITHNQKAPLCNGTMVWSVNLTGSVYCA
ALESLVNVSGCNAIQRTQRMLSGLCTDKAVAKQVTSVQARDTKIELLQFLKELRRHLQML
YRLGKFR
NT seq 564 nt   +upstreamnt  +downstreamnt
atgagtaaagatgtggtttatagatatgtctgccagcggagaccagggtgctggggcgtc
accactcgggcctataaaagctgccacaggaggccagggccacagtcgctcagctgggcc
agcccgcacgcctgctcccgatcctcctctgctgctctgggctccatggcgctctggtgg
gctgtggccattgctgtgacctgccttggcagcctcgtatccccaggccctgtgcctccc
cccacatccctcaaggagctcatcgaggagctggtcaacatcacacacaaccagaaggct
ccactctgcaatggcaccatggtgtggagcgtcaacctgacaggcagcgtgtactgcgca
gccctggagtccctcgtcaatgtctctggctgcaacgccatccagaggacccagcggatg
ctgagcggactctgcacagacaaggctgtggccaagcaggtcaccagcgtgcaagcgcga
gacaccaaaatcgaactgctgcagttcctgaaggagctgcgcaggcacctgcagatgctg
taccgcctggggaagttccgctga

KEGG   Oryctolagus cuniculus (rabbit): 100358914
Entry
100358914         CDS       T03373                                 
Symbol
LIF
Name
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04630  JAK-STAT signaling pathway
ocu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358914 (LIF)
   04668 TNF signaling pathway
    100358914 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358914 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100358914 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358914 (LIF)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100358914 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100358914
NCBI-ProteinID: NP_001232852
Ensembl: ENSOCUG00000003768
LinkDB
Position
Un
AA seq 202 aa
MKILAAGVVPLLLVLHWKPGAGSPLPINPVNATCNTHHPCPSNLMSQIRSQLAQLNGTAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKVRLVELYRIVAYLGTALGNIT
RDQKTLNPTAHSLHSKLNATADTLRGLLSNVLCRLCSKYHVAHVDVAYGPDTSGKDVFQK
KKLGCQLLGKYKQVMAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaagatcttggcggcaggagtcgtgcccctgctgctggtcttgcactggaaacccggg
gcggggagcccccttcccatcaaccccgtcaacgccacctgcaacacacaccacccatgc
cccagcaacctcatgagccagatcaggagccagctggcacagctcaatggcactgccaac
gccctctttattctctattacacagcccaaggggagccgttccccaacaacctggacaag
ctgtgcggccccaatgtgacggacttcccgcccttccacgccaacggcacggagaaggtc
aggctggtggagctgtaccgcatcgtcgcctaccttggcaccgccctgggcaacatcacc
cgggaccagaagaccctcaaccccacggcgcacagcctgcacagcaaactcaacgccacg
gcggacacgctgcggggcctgcttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtggcccacgtggacgtggcctatggcccggacacctcgggcaaggacgtcttccagaag
aagaagctggggtgtcagctgctgggaaaatacaagcaggtcatggccgtgttggcgcag
gccttctag

KEGG   Oryctolagus cuniculus (rabbit): 103349030
Entry
103349030         CDS       T03373                                 
Symbol
IL17D
Name
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103349030 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349030 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103349030 (IL17D)
   04657 IL-17 signaling pathway
    103349030 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349030 (IL17D)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   103349030 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 103349030
NCBI-ProteinID: XP_008258148
Ensembl: ENSOCUG00000003940
LinkDB
Position
8:complement(43865156..43885936)
AA seq 209 aa
MARPEGWMLVAGFLLALPPGRAAGAPRSGRLPARPRGCADRPEELLEQLYGRLAAGVLSA
FHHTLQLGPREQARNASCPAGGRPADRRFRTPTNLRSVSPWAYRISYDPARYPRYLPEAY
CLCRGCLTGLFGEEDFHFRSTPVYMPTVVLRRTPACAGGRAVYTEDYVTIPVGCTCVPEQ
EKDADSLNSSMDKQGAKLLLSPNDQPASS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcgcccggagggctggatgctcgtggccggcttcctgctggcgctgccgccgggc
cgggcggcgggcgcgccgaggagtggcaggctcccggcgcggccgcggggctgcgcggac
cggcccgaggagctcctggagcagctgtacgggcggctggcggccggggtgctcagcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgcaacgcgagctgcccagca
gggggcaggcccgccgaccgccgcttccggacgcccaccaacctgcgcagcgtgtcgccc
tgggcctacagaatctcctacgacccggccaggtaccctaggtacctgcccgaagcctac
tgcctgtgccgcggctgcctgacggggctcttcggggaggaggacttccacttccgcagc
accccggtgtacatgcccaccgtcgtgctgcgccgcaccccggcctgcgccggcggccgc
gccgtctacaccgaggactacgtcaccatccccgtgggctgcacctgcgtccccgagcag
gagaaggacgcggacagcctcaactccagcatggacaagcagggcgccaagctgctgctc
agccccaacgaccagccggccagctcctga

KEGG   Oryctolagus cuniculus (rabbit): 103349580
Entry
103349580         CDS       T03373                                 
Symbol
TSLP
Name
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103349580 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349580 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349580 (TSLP)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   103349580 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 103349580
NCBI-ProteinID: XP_017200128
LinkDB
Position
11:30780100..30782925
AA seq 119 aa
MILPVDLRFFTVFCRISFPSFQTKSTEFNPTISCHNPSECLSTIERDTFTPTPGCASLPT
ADFARKTWAVFALRCPGYSRVQINSLQEVKKGEDTTNNCLEKASHLLGLWRRFSRISEE
NT seq 360 nt   +upstreamnt  +downstreamnt
atgattttgcctgtggacttaagattctttaccgttttttgccgaatttcttttccttcc
ttccagaccaaaagtaccgagttcaaccccaccatctcctgtcacaatccgtcggagtgc
ctcagtaccatcgaacgcgacaccttcactcccaccccaggctgtgcgtccctccccacc
gcagacttcgcccggaaaacctgggccgtctttgctctccggtgccccggctactccaga
gttcagataaatagtttgcaggaagtgaagaaaggagaagacacaaccaataactgcctg
gaaaaagcctcacacttactaggattgtggcgtcgttttagtcgaatttcagaagaataa

KEGG   Oryctolagus cuniculus (rabbit): 108175610
Entry
108175610         CDS       T03373                                 
Name
(RefSeq) cardiotrophin-2
  KO
K24382  cardiotrophin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    108175610
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108175610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    108175610
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   108175610
SSDB
Motif
Pfam: PRF CNTF LIF_OSM
Other DBs
NCBI-GeneID: 108175610
NCBI-ProteinID: XP_017193235
LinkDB
Position
Un
AA seq 203 aa
MSGRLAPLCLLALLLPPLRPAAPLSPAEPISQAYSLALYMQKNTSTLLQTYLQHQGSPFS
DPGFSAPELQLSSLPPATVSFKVWHALDDGERLSRAQEAFLALTQHLQLVGDDQSDLNPD
SPILLAQLSAARLRAQGLLGNMAAIMAALGLPIPKEEDTLGLVPFGASAFERKCRGYVVT
REYGHWTDRVVRDLALLKAKYPA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagcgggcggctggccccgctgtgcctgctggccctgctgctgcccccgctccggccc
gcggcccccctgtccccagctgagcccatcagccaagcctacagcctggcgctgtacatg
cagaagaatacatcgacgctactccagacctacctccagcaccagggcagccccttcagc
gatcccggcttctcagccccggagctccagctcagcagcctgccccctgctacggtctcc
ttcaaggtctggcacgccctggatgacggggagcggctgagccgggcccaggaggccttc
ctggccctgacccaacacctgcagctcgtgggcgacgaccagagcgacctgaatcctgac
agtcccatcctgctggcccagctcagcgctgcaagactcagggcccaaggccttctgggc
aacatggctgccatcatggccgccctggggctgcctatacccaaggaagaggacactctt
ggacttgtcccctttggggcctccgccttcgagaggaaatgtcgaggctacgtggtaacc
cgggaatatggtcactggacagaccgggttgtgagggacttggctctgctcaaggccaaa
tacccagcctag

DBGET integrated database retrieval system