KEGG   Oryctolagus cuniculus (rabbit): 100008645
Entry
100008645         CDS       T03373                                 

Symbol
TGFB1
Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008645 (TGFB1)
   04350 TGF-beta signaling pathway
    100008645 (TGFB1)
   04390 Hippo signaling pathway
    100008645 (TGFB1)
   04068 FoxO signaling pathway
    100008645 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008645 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100008645 (TGFB1)
   04218 Cellular senescence
    100008645 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100008645 (TGFB1)
   04672 Intestinal immune network for IgA production
    100008645 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100008645 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008645 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008645 (TGFB1)
   05205 Proteoglycans in cancer
    100008645 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008645 (TGFB1)
   05212 Pancreatic cancer
    100008645 (TGFB1)
   05225 Hepatocellular carcinoma
    100008645 (TGFB1)
   05226 Gastric cancer
    100008645 (TGFB1)
   05220 Chronic myeloid leukemia
    100008645 (TGFB1)
   05211 Renal cell carcinoma
    100008645 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008645 (TGFB1)
   05161 Hepatitis B
    100008645 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100008645 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008645 (TGFB1)
   05144 Malaria
    100008645 (TGFB1)
   05145 Toxoplasmosis
    100008645 (TGFB1)
   05140 Leishmaniasis
    100008645 (TGFB1)
   05142 Chagas disease
    100008645 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008645 (TGFB1)
   05321 Inflammatory bowel disease
    100008645 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100008645 (TGFB1)
   05414 Dilated cardiomyopathy
    100008645 (TGFB1)
   05415 Diabetic cardiomyopathy
    100008645 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008645 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008645 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100008645 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008645 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008645 (TGFB1)
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   100008645 (TGFB1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100008645 (TGFB1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100008645 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100008645
NCBI-ProteinID: XP_008247926
LinkDB
Position
Un
AA seq 392 aa
MPPSGLRLLLPLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLR
LASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVDSNN
KIYKKYKESRHSVYMLFNTSELREAVPEPVLLSRAELRLQRLKLQQEQHVELYQKYSNDS
WRYLSNRLLAPSNTAEWLSFDVTGVVRQWLSHGEEIEGFRLSAHCSCDNKDNVLQVDING
ISSGRRGDLATIHSMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQL
YIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctacggctgcttctgccgctgctgctgctgccgctgctgtggctc
ctagtgttgacgcccggccggccggccgcgggactgtccacctgcaagaccatcgacatg
gagctggtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaactgcgg
ctcgccagtcccccgagccagggggaggtgccgcccggtccgcttcccgaggccgtgctc
gccctgtacaacagcacccgcgaccgggtggccggggagagcgccgagccggagccggag
cccgaggccgactactacgccaaggaggtcacccgcgtgctaatggtggacagcaacaac
aaaatctacaaaaaatacaaagaaagccggcatagcgtctatatgctgtttaacacgtca
gagctccgggaagcagtgcccgagcccgtgttgctgtccagggcagagctgcgcctgcag
aggctcaagttacagcaggagcagcacgtggagctgtaccagaaatacagcaacgattcc
tggcgctacctcagcaaccggctgctggccccaagcaacacagcagagtggttgtccttc
gatgtcactggagttgtgaggcagtggctgagccacggagaggaaatagagggcttccgc
ctcagcgcccactgttcctgtgacaacaaagataatgtcctccaagtggacatcaacggg
atcagttccggccgtcgaggtgacctggccaccattcacagcatgaaccgacccttcctg
ctcctcatggccacccctctggaacgggctcaacatctacacagttcccggcaccgccga
gccctggacaccaactactgcttcagctccacagagaagaactgctgtgtgcggcagctg
tacattgacttccgcaaggacctgggctggaagtggatccacgagcccaagggctaccac
gccaacttctgcctgggaccctgcccctacatctggagcctggacacccagtacagcaag
gtcctggccctgtacaaccagcacaacccgggcgcgtcggcagcgccgtgctgtgtgcca
caggcgctggagccactgcccatcgtgtactacgtgggccgcaagcccaaggtggagcag
ctgtccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Oryctolagus cuniculus (rabbit): 100009371
Entry
100009371         CDS       T03373                                 

Symbol
TGFB2
Name
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009371 (TGFB2)
   04350 TGF-beta signaling pathway
    100009371 (TGFB2)
   04390 Hippo signaling pathway
    100009371 (TGFB2)
   04068 FoxO signaling pathway
    100009371 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009371 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100009371 (TGFB2)
   04218 Cellular senescence
    100009371 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009371 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009371 (TGFB2)
   05206 MicroRNAs in cancer
    100009371 (TGFB2)
   05205 Proteoglycans in cancer
    100009371 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100009371 (TGFB2)
   05212 Pancreatic cancer
    100009371 (TGFB2)
   05225 Hepatocellular carcinoma
    100009371 (TGFB2)
   05226 Gastric cancer
    100009371 (TGFB2)
   05220 Chronic myeloid leukemia
    100009371 (TGFB2)
   05211 Renal cell carcinoma
    100009371 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009371 (TGFB2)
   05161 Hepatitis B
    100009371 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100009371 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009371 (TGFB2)
   05144 Malaria
    100009371 (TGFB2)
   05145 Toxoplasmosis
    100009371 (TGFB2)
   05140 Leishmaniasis
    100009371 (TGFB2)
   05142 Chagas disease
    100009371 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009371 (TGFB2)
   05321 Inflammatory bowel disease
    100009371 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100009371 (TGFB2)
   05414 Dilated cardiomyopathy
    100009371 (TGFB2)
   05415 Diabetic cardiomyopathy
    100009371 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009371 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009371 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009371 (TGFB2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100009371 (TGFB2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100009371 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100009371
NCBI-ProteinID: NP_001076129
Ensembl: ENSOCUG00000005279
UniProt: Q6T7C3
LinkDB
Position
16
AA seq 442 aa
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSYFPSETVCPV
VTTPSGSVGSLCARQSQVLCGYLDAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVF
RLQNPKARVAEQHIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtggcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctaagcaagctgaagctcaccagccccccagaagactatcccgagccc
gaggaagtgcccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtctacaagatagacatgccgtcctacttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgcgccagacagtcccaggtgctctgt
gggtaccttgatgccatcccacccaccttctacagaccctacttcagaattgtccgattt
gatgtttcaacaatggagaagaatgcttccaatctggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtggctgaacaacacatagaactgtatcagattctc
aaatccaaggatttaacatctccaacccagcgctacatcgacagcaaagtcgtgaaaaca
agagcagaaggcgaatggctctccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaatctgggattcaaaataagtttacattgtccctgctgcacctttgta
ccttctaataattacatcatcccgaataaaagtgaagaactagaagcaagatttgcaggt
attgatggcacctctacatataccagtggggatcagaaaactataaagtccactaggaaa
aaaaacagtggaaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgcattggatgcagcctattgctttagaaat
gtgcaggataattgctgcctgcgtccactctacattgatttcaagagggatcttgggtgg
aaatggatacatgaacctaaagggtataatgccaacttctgtgctggggcatgcccgtat
ttatggagttcagacactcagcacagtagggtcctcagcttatataacaccataaatcca
gaagcatccgcttctccttgctgtgtgtcccaggatttagaacccctaacaattctctac
tatattggcaaaacacccaagattgaacagctttctaatatgatcgtaaagtcttgcaaa
tgcagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100352301
Entry
100352301         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352301
   04350 TGF-beta signaling pathway
    100352301
   04390 Hippo signaling pathway
    100352301
   04068 FoxO signaling pathway
    100352301
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352301
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100352301
   04218 Cellular senescence
    100352301
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100352301
   04672 Intestinal immune network for IgA production
    100352301
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100352301
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100352301
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352301
   05205 Proteoglycans in cancer
    100352301
  09162 Cancer: specific types
   05210 Colorectal cancer
    100352301
   05212 Pancreatic cancer
    100352301
   05225 Hepatocellular carcinoma
    100352301
   05226 Gastric cancer
    100352301
   05220 Chronic myeloid leukemia
    100352301
   05211 Renal cell carcinoma
    100352301
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352301
   05161 Hepatitis B
    100352301
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100352301
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100352301
   05144 Malaria
    100352301
   05145 Toxoplasmosis
    100352301
   05140 Leishmaniasis
    100352301
   05142 Chagas disease
    100352301
  09163 Immune disease
   05323 Rheumatoid arthritis
    100352301
   05321 Inflammatory bowel disease
    100352301
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100352301
   05414 Dilated cardiomyopathy
    100352301
   05415 Diabetic cardiomyopathy
    100352301
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100352301
   04933 AGE-RAGE signaling pathway in diabetic complications
    100352301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100352301
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100352301
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100352301
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   100352301
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100352301
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100352301
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100352301
NCBI-ProteinID: XP_017193741
LinkDB
Position
Un
AA seq 376 aa
MAPSGMRLLLPLLWLSVLAPGRPAAEMPGRNATDLELQQRQHLEAFRALLLSKLKTPSPE
EEPTIPEPDDVDHSTREQNEEGLELLPRYFRKEVTRVPMLDSNHEIYKKYKDCGHSVYML
FNMSELRQAVPEPVLLSRAELRMQVLKLQQEQHVELYQKDSSDSWQYIKSRNLAPSDTDE
WLSIVVTRVVRTWLSRGEETEGFRLSTHCSCDSTDDVLQVDINGISSGRRGDLATIHSMN
RPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEP
KGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKP
KVEQLSNMIVRSCKCS
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcgccctccgggatgcgactgctgctgccgctgctgtggctctcagtgttggcgccc
ggccgaccggccgcggaaatgcccggccgcaacgccaccgacctggagctgcagcaaagg
cagcacctggaggccttccgtgccctgctcctgtccaagctgaagacccccagcccggag
gaggaaccaaccattccggagcctgacgacgtggaccacagcacccgcgaacagaacgag
gagggccttgagctgttgccccgctacttccgcaaggaggtcacccgcgtgccaatgctg
gacagcaaccacgaaatttacaaaaaatacaaagattgcgggcacagcgtctatatgctc
ttcaacatgtcagagctccggcaagcagtgcctgagccggtgttgctgtccagggcagag
ctgcgcatgcaagtgctcaagttacagcaggagcagcacgtggagctgtaccagaaagac
agcagcgattcctggcaatacatcaagagccggaatctggcacccagtgacacagatgag
tggttgtccattgttgtcaccagagttgtgcggacgtggctgagccgtggagaggaaaca
gagggcttccgcctcagcacccactgctcctgtgacagcacagatgatgtcctccaagtg
gacatcaacgggatcagttccggccgtcgaggtgacctggccaccattcacagcatgaac
cgacccttcctgctcctcatggccacccctctggaacgggctcaacatctacacagttcc
cggcaccgccgagccctggacaccaactactgcttcagctccacagagaagaactgctgt
gtgcggcagctgtacattgacttccgcaaggacctgggctggaagtggatccacgagccc
aagggctaccacgccaacttctgcctgggaccctgcccctacatctggagcctggacacc
cagtacagcaaggtcctggccctgtacaaccagcacaacccgggcgcgtcggcagcgccg
tgctgtgtgccacaggcgctggagccactgcccatcgtgtactacgtgggccgcaagccc
aaggtggagcagctgtccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Oryctolagus cuniculus (rabbit): 100352552
Entry
100352552         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352552
   04350 TGF-beta signaling pathway
    100352552
   04390 Hippo signaling pathway
    100352552
   04068 FoxO signaling pathway
    100352552
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352552
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100352552
   04218 Cellular senescence
    100352552
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100352552
   04672 Intestinal immune network for IgA production
    100352552
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100352552
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100352552
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352552
   05205 Proteoglycans in cancer
    100352552
  09162 Cancer: specific types
   05210 Colorectal cancer
    100352552
   05212 Pancreatic cancer
    100352552
   05225 Hepatocellular carcinoma
    100352552
   05226 Gastric cancer
    100352552
   05220 Chronic myeloid leukemia
    100352552
   05211 Renal cell carcinoma
    100352552
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352552
   05161 Hepatitis B
    100352552
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100352552
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100352552
   05144 Malaria
    100352552
   05145 Toxoplasmosis
    100352552
   05140 Leishmaniasis
    100352552
   05142 Chagas disease
    100352552
  09163 Immune disease
   05323 Rheumatoid arthritis
    100352552
   05321 Inflammatory bowel disease
    100352552
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100352552
   05414 Dilated cardiomyopathy
    100352552
   05415 Diabetic cardiomyopathy
    100352552
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100352552
   04933 AGE-RAGE signaling pathway in diabetic complications
    100352552
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100352552
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100352552
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100352552
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   100352552
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100352552
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100352552
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 100352552
NCBI-ProteinID: XP_017193719
LinkDB
Position
Un
AA seq 257 aa
MEASGRQSGQDPWCRAGSPPKGTLGLKVTQLKSVSPTPTWGCLCFFYPCQSSDSSVCSSQ
LEIYKKYKDCGHSVYMLFNMSELRQAVPEPVLLSRVELRMQVLKLQQEQHMELYQKDSSD
SWQYIKSRNLAPSDTDEWFSIVVTRVVRTWLSRGEEIEGFRLSTHCSCDSTDDVLQLDIN
GISSGRRGNHAAAHSMNRPFLLLVATPLKRALKLYGTWDHXALDTNYCFRFLWNSPQTDI
SLDGFPVQGRAATALTA
NT seq 774 nt   +upstreamnt  +downstreamnt
atggaggcctcaggtagacagagtggtcaggacccatggtgcagggcaggaagcccaccc
aaagggaccctgggcctcaaggtcactcagctgaaaagtgtcagtccaactccaacctgg
gggtgcctctgcttcttttacccctgccaaagctctgactcctctgtctgctcctcccaa
ctagaaatctacaaaaaatacaaagattgtgggcacagcgtctatatgctcttcaacatg
tcagagctccggcaagcagtgcccgagccggtgttgctgtcccgggtggagctgcgcatg
caagtgctcaagttacagcaggagcagcacatggagctgtaccagaaagacagcagcgat
tcctggcaatacatcaagagccggaatctggcacccagtgacacagatgagtggttttcc
attgttgtcaccagagttgtgcggacgtggctgagccgtggagaggaaatagagggcttc
cgcctcagcacccactgctcctgtgacagcacagatgatgtcctccaactggacatcaac
gggatcagttccggccgccgaggtaaccatgccgccgctcatagcatgaaccggcccttc
ctgctccttgtggctacccccctaaagagggcactgaaactatatggcacctgggaccac
tgagccctggacaccaactactgcttcagattcctgtggaattctccacagacggacatt
tctttagacggctttcctgtccagggcagggcggccacggctctgacggcctga

KEGG   Oryctolagus cuniculus (rabbit): 100352810
Entry
100352810         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352810
   04350 TGF-beta signaling pathway
    100352810
   04390 Hippo signaling pathway
    100352810
   04068 FoxO signaling pathway
    100352810
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352810
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100352810
   04218 Cellular senescence
    100352810
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100352810
   04672 Intestinal immune network for IgA production
    100352810
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100352810
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100352810
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352810
   05205 Proteoglycans in cancer
    100352810
  09162 Cancer: specific types
   05210 Colorectal cancer
    100352810
   05212 Pancreatic cancer
    100352810
   05225 Hepatocellular carcinoma
    100352810
   05226 Gastric cancer
    100352810
   05220 Chronic myeloid leukemia
    100352810
   05211 Renal cell carcinoma
    100352810
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352810
   05161 Hepatitis B
    100352810
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100352810
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100352810
   05144 Malaria
    100352810
   05145 Toxoplasmosis
    100352810
   05140 Leishmaniasis
    100352810
   05142 Chagas disease
    100352810
  09163 Immune disease
   05323 Rheumatoid arthritis
    100352810
   05321 Inflammatory bowel disease
    100352810
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100352810
   05414 Dilated cardiomyopathy
    100352810
   05415 Diabetic cardiomyopathy
    100352810
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100352810
   04933 AGE-RAGE signaling pathway in diabetic complications
    100352810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100352810
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100352810
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100352810
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   100352810
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100352810
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100352810
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 100352810
NCBI-ProteinID: XP_017193720
LinkDB
Position
Un
AA seq 284 aa
MLPSGMRLLLPLLWLLVLSPARPAVGTLSRNNTHMELLRQQHIQAVGALILAKLGLSSPP
SDDEVPTGPVPEDILALYNRTRDQVSGERAKQKPQPDSGFFGKEITSVPMLDSNHEIYQK
YKESWHSVYMFFNTSELRHAVPKPVLLSHAELRLQVLKLQQEQHVELYQKCSNDSWRYYR
RRKLTPSDTDEWLSFTVTWIVRQWLRGGEEIEGFRLSARRSSDNTDDVLQVDINGISSGR
QGDDANTERMTRPFLLLWATPLEREQLLHSAQXRLSLDTNYCFR
NT seq 855 nt   +upstreamnt  +downstreamnt
atgctgccctccgggatgcgactgctgctgcctctgctgtggctcctggtgctgtcaccc
gcccgcccagccgtgggaacgctcagccgcaacaacacccacatggagctgctcagacaa
cagcacatccaggccgtcggcgccctgatcctggccaagctggggctctccagcccccca
agtgatgatgaggtgccgacgggtccggtgcccgaggacatactcgccctgtacaacaga
acccgcgatcaggtgtccggggagagagctaaacagaagccccaacccgactcaggcttc
tttggcaaggagatcaccagtgtgccaatgctggacagcaaccacgaaatctaccaaaaa
tacaaagaaagttggcacagcgtctatatgttcttcaacacgtcagagctccggcatgca
gtgcccaagccggtgttgctgtcccatgcagagctgcgcctgcaagtgctcaagttacag
caggagcagcacgtggagctgtaccagaaatgcagcaacgattcctggcgctactacagg
aggcgtaagctgacacccagtgacacagatgagtggttgtcatttaccgtcacctggatt
gtgcggcagtggctgagaggtggagaggaaatagagggcttccgcctcagcgcccggagg
tccagtgacaacacagatgatgtcctccaagtggacatcaacgggatcagttctggccgc
caaggggacgatgccaacactgagagaatgacccggcccttcttgctcctctgggccacc
cccctggaacgggagcagctgctacacagcgcccagnctcggctgagcctggacaccaac
tactgcttcaggtga

KEGG   Oryctolagus cuniculus (rabbit): 100353067
Entry
100353067         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100353067
   04350 TGF-beta signaling pathway
    100353067
   04390 Hippo signaling pathway
    100353067
   04068 FoxO signaling pathway
    100353067
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353067
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100353067
   04218 Cellular senescence
    100353067
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100353067
   04672 Intestinal immune network for IgA production
    100353067
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100353067
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100353067
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353067
   05205 Proteoglycans in cancer
    100353067
  09162 Cancer: specific types
   05210 Colorectal cancer
    100353067
   05212 Pancreatic cancer
    100353067
   05225 Hepatocellular carcinoma
    100353067
   05226 Gastric cancer
    100353067
   05220 Chronic myeloid leukemia
    100353067
   05211 Renal cell carcinoma
    100353067
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100353067
   05161 Hepatitis B
    100353067
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100353067
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100353067
   05144 Malaria
    100353067
   05145 Toxoplasmosis
    100353067
   05140 Leishmaniasis
    100353067
   05142 Chagas disease
    100353067
  09163 Immune disease
   05323 Rheumatoid arthritis
    100353067
   05321 Inflammatory bowel disease
    100353067
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100353067
   05414 Dilated cardiomyopathy
    100353067
   05415 Diabetic cardiomyopathy
    100353067
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100353067
   04933 AGE-RAGE signaling pathway in diabetic complications
    100353067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100353067
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353067
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100353067
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   100353067
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100353067
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100353067
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 100353067
NCBI-ProteinID: XP_008247923
Ensembl: ENSOCUG00000016689
LinkDB
Position
Un
AA seq 289 aa
MPPSGLRLLLPLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLR
LASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVDSNN
KIYKKYKESRHSVYMLFNTSELREAVPEPVLLSRAELRLQRLKLQQEQHVELYQKYSNDS
WRYLSNRLLAPSNTAEWLSFDVTGVVRQWLSHGEEIEGFRLSTQRSSDSTDDVLQVDING
ISSGRQGDDANTERMTRPFLLLWATPLEREQLLHSAQXRLSLDTNYCFR
NT seq 870 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctacggctgcttctgccgctgctgctgctgccgctgctgtggctc
ctagtgttgacgcccggccggccggccgcgggactgtccacctgcaagaccatcgacatg
gagctggtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaactgcgg
ctcgccagtcccccgagccagggggaggtgccgcccggtccgcttcccgaggccgtgctc
gccctgtacaacagcacccgcgaccgggtggccggggagagcgccgagccggagccggag
cccgaggccgactactacgccaaggaggtcacccgcgtgctaatggtggacagcaacaac
aaaatctacaaaaaatacaaagaaagccggcatagcgtctatatgctgtttaacacgtca
gagctccgggaagcagtgcccgagcccgtgttgctgtccagggcagagctgcgcctgcag
aggctcaagttacagcaggagcagcacgtggagctgtaccagaaatacagcaacgattcc
tggcgctacctcagcaaccggctgctggccccaagcaacacagcagagtggttgtccttc
gatgtcactggagttgtgcgacagtggctgagccacggagaggaaatagagggcttccgc
ctcagcacccagaggtccagtgacagcacagatgatgtcctccaagtggacatcaacggg
atcagttctggccgccaaggggacgatgccaacactgagagaatgacccggcccttcttg
ctcctctgggccacccccctggaacgggagcagctgctacacagcgcccagnctcggctg
agcctggacaccaactactgcttcaggtga

KEGG   Oryctolagus cuniculus (rabbit): 100358982
Entry
100358982         CDS       T03373                                 

Symbol
TGFB3
Name
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100358982 (TGFB3)
   04350 TGF-beta signaling pathway
    100358982 (TGFB3)
   04390 Hippo signaling pathway
    100358982 (TGFB3)
   04068 FoxO signaling pathway
    100358982 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358982 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100358982 (TGFB3)
   04218 Cellular senescence
    100358982 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358982 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100358982 (TGFB3)
   05212 Pancreatic cancer
    100358982 (TGFB3)
   05225 Hepatocellular carcinoma
    100358982 (TGFB3)
   05226 Gastric cancer
    100358982 (TGFB3)
   05220 Chronic myeloid leukemia
    100358982 (TGFB3)
   05211 Renal cell carcinoma
    100358982 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100358982 (TGFB3)
   05161 Hepatitis B
    100358982 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100358982 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100358982 (TGFB3)
   05144 Malaria
    100358982 (TGFB3)
   05145 Toxoplasmosis
    100358982 (TGFB3)
   05140 Leishmaniasis
    100358982 (TGFB3)
   05142 Chagas disease
    100358982 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100358982 (TGFB3)
   05321 Inflammatory bowel disease
    100358982 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100358982 (TGFB3)
   05414 Dilated cardiomyopathy
    100358982 (TGFB3)
   05415 Diabetic cardiomyopathy
    100358982 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100358982 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358982 (TGFB3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100358982 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100358982
NCBI-ProteinID: XP_002719681
UniProt: G1T192
LinkDB
Position
20
AA seq 458 aa
MHLLAKPQSLGSGEAAWFPSLLLHVCRGLLLSRPRRPPWPLSPARPMKMHLQRALVVLAL
LNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVMTHVPYQVLALYN
STRELLEELQAEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRF
NVSSVEKNGTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTR
GTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVD
NEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLGSPGQGAQRKKRALDTNYCFRNLEEN
CCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASA
SPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtctttgggatctggggaggccgcctggtttccctcc
ctccttctgcacgtctgccggggtctcctcctctccaggccgcgccgccccccctggcct
ctctccccggctcgccccatgaagatgcacttgcaaagggctctggtggtcctggccctg
ctgaactttgccacggtcagcctctctctgtccacttgcaccaccttggacttcggccac
atcaaaaagaagagagtggaagccattaggggacagatcttgagcaagctcaggctcacc
agcccccctgagccgtcggtgatgacccacgtcccctaccaggtcctggccctttataac
agcactcgggagctgctggaggagctgcaggcagagagggaggaaggctgcactcaggaa
aacaccgagtcggaatactatgccaaagagatccataaattcgacatgatccagggactg
gcggagcacaacgagctggccgtgtgtcccaaaggaatcacctccaaggttttccgcttc
aacgtgtcctcagtggagaagaacggaaccaacctgttccgggcagaattccgggtcttg
cgtgtgcccaaccccagctccaagcgcaacgagcagaggattgagctcttccagatcctc
cggccggatgagcacatcgccaagcagcgctacatcggcggcaagaatctgcccacgcgg
ggcaccgccgagtggctgtcctttgacgtcacggacaccgtgcgcgagtggctgctgcga
agagagtccaacttgggtctggagatcagcattcattgtccgtgccacacctttcagccc
aacggagacatcctggaaaacattcacgaggtgatggaaataaaattcaaaggcgtggac
aacgaggacgaccacggccgtggcgatctagggcggctcaagaagcagaaggatcaccac
aaccctcacctcatcctcatgatgattccaccgcaccggctcggcagcccgggccagggc
gcacagaggaagaagcgggccctggacaccaattactgcttccgcaacttggaggagaac
tgctgtgtgcgtccactctacattgacttccgccaggatctgggctggaaatgggtccac
gaacccaagggctactacgccaacttctgctctggcccgtgcccatacctccgcagtgca
gacaccacccacagcacggtgctgggactctacaacaccctgaacccggaagcctcggcc
tcgccctgctgcgtccctcaggacttggagcccctgaccatcctgtactacgtcgggagg
acccccaaggtggagcagctctccaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Oryctolagus cuniculus (rabbit): 103345448
Entry
103345448         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103345448
   04350 TGF-beta signaling pathway
    103345448
   04390 Hippo signaling pathway
    103345448
   04068 FoxO signaling pathway
    103345448
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345448
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103345448
   04218 Cellular senescence
    103345448
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103345448
   04672 Intestinal immune network for IgA production
    103345448
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103345448
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103345448
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345448
   05205 Proteoglycans in cancer
    103345448
  09162 Cancer: specific types
   05210 Colorectal cancer
    103345448
   05212 Pancreatic cancer
    103345448
   05225 Hepatocellular carcinoma
    103345448
   05226 Gastric cancer
    103345448
   05220 Chronic myeloid leukemia
    103345448
   05211 Renal cell carcinoma
    103345448
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103345448
   05161 Hepatitis B
    103345448
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103345448
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103345448
   05144 Malaria
    103345448
   05145 Toxoplasmosis
    103345448
   05140 Leishmaniasis
    103345448
   05142 Chagas disease
    103345448
  09163 Immune disease
   05323 Rheumatoid arthritis
    103345448
   05321 Inflammatory bowel disease
    103345448
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103345448
   05414 Dilated cardiomyopathy
    103345448
   05415 Diabetic cardiomyopathy
    103345448
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103345448
   04933 AGE-RAGE signaling pathway in diabetic complications
    103345448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    103345448
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103345448
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    103345448
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   103345448
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103345448
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103345448
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 103345448
NCBI-ProteinID: XP_017193743
LinkDB
Position
Un
AA seq 267 aa
MLPCGMRLLLPLLWLLVLSPARPAAGMPSRNTTEVELLRQQHIEAVHSTIQSPPSEEEVP
EDVLTLNSRTHDQGSGESNKQEPKPKLNFSAGKELTGVPMLESDHESYQKFNVSRHSVYM
LFNMSELREVMPEPWLLSGAELHLQVLKLQQEQHMELYQKDSNDSWRYLSNRLLAPSNTA
EWLSFDVTGVVQQWLSHGGEDEEIEGFRLSARRSSDNTDDVLHVKINGISSSGQGDNANV
QKSYRPYLLLIVNPLDRIVPPDPSELI
NT seq 804 nt   +upstreamnt  +downstreamnt
atgctgccctgcgggatgcgactgctgctgcctctgctgtggctcctggtgttgtcaccc
gcccgcccagccgcaggaatgcccagccgcaacaccaccgaggtggagctgctcagacaa
cagcacatcgaggccgttcactccacgatccagagccccccgagcgaggaggaagtgccc
gaagacgtgctcaccctgaacagcagaacccatgaccaggggtctggagagagcaataag
caagagcccaaacccaagttaaacttctctgcaggcaaggagctcaccggcgtgccaatg
ctggagagcgaccacgaaagctatcaaaaattcaacgtaagccggcacagcgtctatatg
ctcttcaacatgtcagagctccgggaagtaatgccagagccatggttgctgtctggggca
gagctgcacctgcaagtgctcaagttacagcaggagcagcacatggagctgtaccagaaa
gacagcaatgattcctggcgctacctcagcaaccggctgctggccccaagcaacacagca
gagtggttgtccttcgatgtcactggagttgtgcagcagtggctgagccacggaggtgaa
gatgaggaaatagagggcttccgcctcagcgcccggaggtccagtgacaacacagatgat
gtcctccatgtgaaaatcaatgggatcagttccagtggccagggtgacaatgccaacgtt
cagaaatcctaccggccctatctgctcctcatcgtcaacccactggaccgcattgtgccc
ccagacccctcggagctgatctga

KEGG   Oryctolagus cuniculus (rabbit): 103345451
Entry
103345451         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103345451
   04350 TGF-beta signaling pathway
    103345451
   04390 Hippo signaling pathway
    103345451
   04068 FoxO signaling pathway
    103345451
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345451
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103345451
   04218 Cellular senescence
    103345451
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103345451
   04672 Intestinal immune network for IgA production
    103345451
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103345451
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103345451
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345451
   05205 Proteoglycans in cancer
    103345451
  09162 Cancer: specific types
   05210 Colorectal cancer
    103345451
   05212 Pancreatic cancer
    103345451
   05225 Hepatocellular carcinoma
    103345451
   05226 Gastric cancer
    103345451
   05220 Chronic myeloid leukemia
    103345451
   05211 Renal cell carcinoma
    103345451
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103345451
   05161 Hepatitis B
    103345451
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103345451
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103345451
   05144 Malaria
    103345451
   05145 Toxoplasmosis
    103345451
   05140 Leishmaniasis
    103345451
   05142 Chagas disease
    103345451
  09163 Immune disease
   05323 Rheumatoid arthritis
    103345451
   05321 Inflammatory bowel disease
    103345451
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103345451
   05414 Dilated cardiomyopathy
    103345451
   05415 Diabetic cardiomyopathy
    103345451
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103345451
   04933 AGE-RAGE signaling pathway in diabetic complications
    103345451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    103345451
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103345451
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    103345451
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   103345451
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103345451
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103345451
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 103345451
NCBI-ProteinID: XP_017193717
UniProt: A0A5F9CDR7
LinkDB
Position
Un
AA seq 203 aa
MSPSPMRRLLLLWLAVLMPGRLAAGTPSCNATDMELPKQQIEAVRAAVLPKVGLSRTLNK
REVPPGPVPEDTLVQYNRRHDQVGRKSTEQKPQSQPVFDIFTKFFHMLMVDSNHEIYKTY
KESRHSVYMFFNTSELRQVVPEPVMLSQAELHLQVLKIQQEQHVELYQKYNNSWRYLRSW
KLTPIDTNDGCPRSHRCAAVAER
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtcgccctcccccatgcgacggctgctgctgctgtggctcgcagtgttgatgcccggc
cggctggccgcgggaacgcctagctgcaacgccaccgacatggagctgcccaaacagcaa
atcgaggcggtccgcgccgcagtcctgcccaaggtggggctgtcccgcaccctgaataag
agggaggtgccgcctggtccagtgccagaggacacgctcgtccagtacaacagaagacac
gaccaggtgggcaggaagagcaccgagcagaagccacagtcccagccagtgttcgacatc
ttcactaagttcttccacatgctaatggtggacagcaaccatgaaatctacaaaacatac
aaagaaagccggcacagcgtctatatgttcttcaacacgtcagagctccggcaagtagtg
cccgagccggtgatgctgtcccaggcagagctgcacctgcaagtgctcaagatacagcag
gagcagcacgtggagctgtaccagaaatacaacaattcctggcgctacctcaggagctgg
aagctgacccccatagacaccaatgatggttgtcctcgaagtcacagatgtgcggcagta
gctgagaggtga

KEGG   Oryctolagus cuniculus (rabbit): 103345452
Entry
103345452         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1-like
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103345452
   04350 TGF-beta signaling pathway
    103345452
   04390 Hippo signaling pathway
    103345452
   04068 FoxO signaling pathway
    103345452
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345452
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103345452
   04218 Cellular senescence
    103345452
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103345452
   04672 Intestinal immune network for IgA production
    103345452
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103345452
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103345452
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345452
   05205 Proteoglycans in cancer
    103345452
  09162 Cancer: specific types
   05210 Colorectal cancer
    103345452
   05212 Pancreatic cancer
    103345452
   05225 Hepatocellular carcinoma
    103345452
   05226 Gastric cancer
    103345452
   05220 Chronic myeloid leukemia
    103345452
   05211 Renal cell carcinoma
    103345452
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103345452
   05161 Hepatitis B
    103345452
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103345452
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103345452
   05144 Malaria
    103345452
   05145 Toxoplasmosis
    103345452
   05140 Leishmaniasis
    103345452
   05142 Chagas disease
    103345452
  09163 Immune disease
   05323 Rheumatoid arthritis
    103345452
   05321 Inflammatory bowel disease
    103345452
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103345452
   05414 Dilated cardiomyopathy
    103345452
   05415 Diabetic cardiomyopathy
    103345452
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103345452
   04933 AGE-RAGE signaling pathway in diabetic complications
    103345452
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    103345452
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103345452
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    103345452
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   103345452
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103345452
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103345452
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 103345452
NCBI-ProteinID: XP_017193721
LinkDB
Position
Un
AA seq 301 aa
MLPSGMRLLLPLLWLLVLSPARPAVGTLSRNNTHMELLRQQHIQAVGALILAKLGLSSPP
SDDEVPTGPVPEDILALYNRTRDQVSGERAKQKPQPDSGFFGKEITSVPMLDSNHEIYQK
YKESRHSVYMFFNTSELRQAVPKPVLLSHAELRLQVLKLQQEQQVELYQEEEESNTPCGR
RWQHLPLLSPPCFVLQKCSNDSWRYHRRRKLTPSDTDEWLSFTVTWIVRQWLRGGEEIEG
FRLSTQRSSDSTDDVLQVDINGISSGRQGDDANTERMTRPFLLLWATPLEREQLLHSAQL
G
NT seq 906 nt   +upstreamnt  +downstreamnt
atgctgccctccgggatgcgactgctgctgcctctgctgtggctcctggtgctgtcaccc
gcccgcccagccgtgggaacgctcagccgcaacaacacccacatggagctgctcagacaa
cagcacatccaggccgtcggcgccctgatcctggccaagctggggctctccagcccccca
agtgatgatgaggtgccgacgggtccggtgcccgaggacatactcgccctgtacaacaga
acccgcgatcaggtgtccggggagagagctaaacagaagccccaacccgactcaggcttc
tttggcaaggagatcaccagtgtgccaatgctggacagcaaccacgaaatctaccaaaaa
tacaaagaaagtcggcacagcgtctatatgttcttcaacacgtcagagctccggcaagca
gtgcccaagccggtgttgctgtcccatgcagagctgcgcctgcaagtgctcaagttacag
caggagcagcaggtggagctgtaccaggaggaggaggaatcgaacacgccgtgtgggagg
cgctggcagcatctcccgcttctctctcccccgtgctttgtcctccagaaatgcagcaac
gattcctggcgctaccacaggaggcgtaagctgacacccagtgacacagatgagtggttg
tcatttaccgtcacctggattgtgcggcagtggctgagaggtggagaggaaatagagggc
ttccgcctcagcacccagaggtccagtgacagcacagatgatgtcctccaagtggacatc
aacgggatcagttctggccgccaaggggacgatgccaacactgagagaatgacccggccc
ttcttgctcctctgggccacccccctggaacgggagcagctgctacacagcgcccagctc
ggctga

KEGG   Oryctolagus cuniculus (rabbit): 108175468
Entry
108175468         CDS       T03373                                 

Name
(RefSeq) transforming growth factor beta-1-like
  KO
K13375  transforming growth factor beta-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04659  Th17 cell differentiation
ocu04672  Intestinal immune network for IgA production
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108175468
   04350 TGF-beta signaling pathway
    108175468
   04390 Hippo signaling pathway
    108175468
   04068 FoxO signaling pathway
    108175468
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108175468
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108175468
   04218 Cellular senescence
    108175468
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    108175468
   04672 Intestinal immune network for IgA production
    108175468
  09152 Endocrine system
   04926 Relaxin signaling pathway
    108175468
  09158 Development and regeneration
   04380 Osteoclast differentiation
    108175468
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108175468
   05205 Proteoglycans in cancer
    108175468
  09162 Cancer: specific types
   05210 Colorectal cancer
    108175468
   05212 Pancreatic cancer
    108175468
   05225 Hepatocellular carcinoma
    108175468
   05226 Gastric cancer
    108175468
   05220 Chronic myeloid leukemia
    108175468
   05211 Renal cell carcinoma
    108175468
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108175468
   05161 Hepatitis B
    108175468
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108175468
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108175468
   05144 Malaria
    108175468
   05145 Toxoplasmosis
    108175468
   05140 Leishmaniasis
    108175468
   05142 Chagas disease
    108175468
  09163 Immune disease
   05323 Rheumatoid arthritis
    108175468
   05321 Inflammatory bowel disease
    108175468
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    108175468
   05414 Dilated cardiomyopathy
    108175468
   05415 Diabetic cardiomyopathy
    108175468
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108175468
   04933 AGE-RAGE signaling pathway in diabetic complications
    108175468
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    108175468
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    108175468
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    108175468
Chaperones and folding catalysts [BR:ocu03110]
 Intramolecular chaperones
  Others
   108175468
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108175468
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108175468
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 108175468
NCBI-ProteinID: XP_017193718
LinkDB
Position
Un
AA seq 297 aa
MSPSRMRRLLLLWLAVLMPGRLAAGMPSRSATDMKLPKQQIEAVRAPVLPKVGLSRTLNK
REVPPGPVPEDTLVQYNRRRDQVGRKSTEQKPQPQPVLDFSAKFFHMLMVDSNHALRLGV
TLLLLPLPNPNSSVCSSQLEIYKKYKESRHSVYMFFNTSELRQAVPEPVMLYRAELRLQV
LKLQQEQHVELYQKDNNSWRYLRSRKLTPSDTDEWLSFEVTRIVRQWLRGGEEIVGFRLS
THCSCDNKNNVLQVDINGITSSRQGEQITIENKHRPYVILMATLPEHTYQLLSAQHG
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtcgccctcccgcatgcgacggctgctgctgctgtggctcgcagtgttgatgcccggc
cggctggccgcgggaatgcccagccgcagcgccaccgacatgaagctgcccaaacagcaa
atcgaggcggtccgtgccccagtcctgcccaaggtggggctgtcccgcaccctgaataag
agggaggtgccacccggtccagtgccagaggacacgctcgtccagtacaacagaagacgc
gaccaggtgggcaggaagagcaccgagcagaagccccagccccagccggtattggacttc
tcagctaagttcttccacatgctaatggtggacagcaaccatgctcttagactgggggtg
accctgctccttctaccactgccaaaccccaactcctctgtctgctcctcccaactagaa
atctacaaaaaatacaaagaaagccggcacagcgtctatatgttcttcaacacatcagag
ctccggcaagcagtgcccgagcccgtgatgctgtaccgggcagagctgcgcctgcaagtg
ctcaagttacagcaggagcagcacgtggagctgtaccagaaagacaacaattcctggcgc
tacctcaggagccggaagctgacacccagtgacacagatgagtggttgtccttcgaagtc
accaggattgtgcggcagtggctgagaggtggagaggaaatagtgggtttccgcctcagc
acccactgctcctgtgacaacaaaaataatgtcctccaagtggacatcaacgggatcact
tccagccgccaaggtgagcaaatcaccattgagaacaagcaccgcccctacgtgatcctc
atggccactttgccagagcacacataccagctactcagcgcccagcacggctga

DBGET integrated database retrieval system