KEGG   Oryctolagus cuniculus (rabbit): 100008701
Entry
100008701         CDS       T03373                                 

Symbol
IL10, CSIF, IL-10
Name
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04068  FoxO signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05322  Systemic lupus erythematosus
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100008701 (IL10)
   04068 FoxO signaling pathway
    100008701 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008701 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008701 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100008701 (IL10)
   04660 T cell receptor signaling pathway
    100008701 (IL10)
   04672 Intestinal immune network for IgA production
    100008701 (IL10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100008701 (IL10)
   05133 Pertussis
    100008701 (IL10)
   05150 Staphylococcus aureus infection
    100008701 (IL10)
   05152 Tuberculosis
    100008701 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100008701 (IL10)
   05144 Malaria
    100008701 (IL10)
   05145 Toxoplasmosis
    100008701 (IL10)
   05140 Leishmaniasis
    100008701 (IL10)
   05142 Chagas disease
    100008701 (IL10)
   05143 African trypanosomiasis
    100008701 (IL10)
  09163 Immune disease
   05310 Asthma
    100008701 (IL10)
   05322 Systemic lupus erythematosus
    100008701 (IL10)
   05320 Autoimmune thyroid disease
    100008701 (IL10)
   05321 Inflammatory bowel disease
    100008701 (IL10)
   05330 Allograft rejection
    100008701 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008701 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008701 (IL10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100008701 (IL10)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100008701 (IL10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 100008701
NCBI-ProteinID: NP_001075514
Ensembl: ENSOCUG00000014265
UniProt: Q9TVD3
LinkDB
Position
16
AA seq 178 aa
MXSSAXLCCLVFLGGTGASRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQ
LNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLR
LRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcmcagctcagcmstgctatgttgcctggtcttcctgggtgggacaggggccagccga
ggccaggacacccctgctgagaacagctgcattcactttccaggcggcctgccccacatg
ctccgcgagctccgtgctgcctttggcagggtgaagactttctttcaatcgaaggatcag
ctgaacagcatgttgttaaccgagtccctgctggaggaccttaagggttacctgggatgc
caagccttgtcggagatgatccagttttacctgaaggacgtgatgccgcaagctgagaac
cacagtccagccatcagggagcacgtgaactccctgggggaaaacctgaagaccctcagg
ctgaggctgcgacaatgtcaccgatttctcccctgtgaaaacaagagcaaggcagtggag
caggtgaagagcgccttcagcaagctgcaagaggaaggcgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaaacctacatgacaatgaagataaaaagctaa

DBGET integrated database retrieval system