Oryctolagus cuniculus (rabbit): 100008701 Help Entry 100008701         CDS       T03373                                  Symbol IL10 Name (RefSeq) interleukin-10 precursor   KO K05443   interleukin 10 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04068   FoxO signaling pathway ocu04148   Efferocytosis ocu04625   C-type lectin receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu04660   T cell receptor signaling pathway ocu04672   Intestinal immune network for IgA production ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05143   African trypanosomiasis ocu05144   Malaria ocu05145   Toxoplasmosis ocu05146   Amoebiasis ocu05150   Staphylococcus aureus infection ocu05152   Tuberculosis ocu05310   Asthma ocu05320   Autoimmune thyroid disease ocu05321   Inflammatory bowel disease ocu05322   Systemic lupus erythematosus ocu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100008701 (IL10)    04068 FoxO signaling pathway     100008701 (IL10)   09133 Signaling molecules and interaction    04061 Viral protein interaction with cytokine and cytokine receptor     100008701 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100008701 (IL10)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100008701 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     100008701 (IL10)    05133 Pertussis     100008701 (IL10)    05150 Staphylococcus aureus infection     100008701 (IL10)    05152 Tuberculosis     100008701 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     100008701 (IL10)    05144 Malaria     100008701 (IL10)    05145 Toxoplasmosis     100008701 (IL10)    05140 Leishmaniasis     100008701 (IL10)    05142 Chagas disease     100008701 (IL10)    05143 African trypanosomiasis     100008701 (IL10)   09163 Immune disease    05310 Asthma     100008701 (IL10)    05322 Systemic lupus erythematosus     100008701 (IL10)    05320 Autoimmune thyroid disease     100008701 (IL10)    05321 Inflammatory bowel disease     100008701 (IL10)    05330 Allograft rejection     100008701 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100008701 (IL10)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100008701 (IL10) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Interleukins    100008701 (IL10) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Cytokines    100008701 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 Motif Other DBs NCBI-GeneID:  100008701 NCBI-ProteinID:  NP_001075514 UniProt:  Q9TVD3 LinkDB All DBs Position 16:complement(19916942..19923454) Genome browser AA seq 178 aa AA seqDB search MXSSAXLCCLVFLGGTGASRGQDTPAENSCIHFPGGLPHMLRELRAAFGRVKTFFQSKDQ LNSMLLTESLLEDLKGYLGCQALSEMIQFYLKDVMPQAENHSPAIREHVNSLGENLKTLR LRLRQCHRFLPCENKSKAVEQVKSAFSKLQEEGVYKAMSEFDIFINYIETYMTMKIKS NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcmcagctcagcmstgctatgttgcctggtcttcctgggtgggacaggggccagccga ggccaggacacccctgctgagaacagctgcattcactttccaggcggcctgccccacatg ctccgcgagctccgtgctgcctttggcagggtgaagactttctttcaatcgaaggatcag ctgaacagcatgttgttaaccgagtccctgctggaggaccttaagggttacctgggatgc caagccttgtcggagatgatccagttttacctgaaggacgtgatgccgcaagctgagaac cacagtccagccatcagggagcacgtgaactccctgggggaaaacctgaagaccctcagg ctgaggctgcgacaatgtcaccgatttctcccctgtgaaaacaagagcaaggcagtggag caggtgaagagcgccttcagcaagctgcaagaggaaggcgtctacaaagccatgagtgag tttgacatcttcatcaactacatagaaacctacatgacaatgaagataaaaagctaa

DBGET integrated database retrieval system