KEGG   Oryctolagus cuniculus (rabbit): 100008790
Entry
100008790         CDS       T03373                                 
Symbol
ACTR3, ARP3
Name
(RefSeq) ARP3 actin related protein 3 homolog
  KO
K18584  actin-related protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100008790 (ACTR3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100008790 (ACTR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008790 (ACTR3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100008790 (ACTR3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008790 (ACTR3)
   05135 Yersinia infection
    100008790 (ACTR3)
   05100 Bacterial invasion of epithelial cells
    100008790 (ACTR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008790 (ACTR3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100008790 (ACTR3)
   04147 Exosome [BR:ocu04147]
    100008790 (ACTR3)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100008790 (ACTR3)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100008790 (ACTR3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100008790 (ACTR3)
  Exosomal proteins of other body fluids (saliva and urine)
   100008790 (ACTR3)
  Exosomal proteins of bladder cancer cells
   100008790 (ACTR3)
SSDB
Motif
Pfam: Actin MreB_Mbl ALP_N Robl_LC7
Other DBs
NCBI-GeneID: 100008790
NCBI-ProteinID: XP_002712451
Ensembl: ENSOCUG00000004395
UniProt: G1SLQ4
LinkDB
Position
7:complement(69194591..69252457)
AA seq 418 aa
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggacggctgccggcctgtgtggtggactgtggcacggggtatacaaaactagga
tatgctggaaatacagaaccacagtttatcatcccttcctgtattgctattaaggagtca
gcaaaagtgggtgatcaagctcaaaggagggtgatgaaaggtgttgatgacctagacttc
ttcattggtgatgaagcaatagaaaaacctacatatgcaacaaagtggccaattcgccat
ggtatagttgaagattgggatttgatggaaaggtttatggaacaagtgatctttaaatat
ttaagggcagaacctgaagaccattattttcttttgactgaacctccactgaatactcca
gaaaacagggaatatactgctgaaataatgtttgagtctttcaatgttccaggcttgtac
attgctgtacaggctgttcttgccttagcggcatcctggacctcaagacaagtaggagaa
cggacattgactggtacggtaatagacagtggagatggtgtcactcatgtcattcctgtg
gctgaagggtatgtgattggcagctgtattaaacacattccaatcgcaggacgagatata
acatactttattcagcaactgctgagagaccgagaagtaggaatccctccagaacaatcc
ctggaaactgctaaggcagtaaaggagcgctatagttatgtctgcccagatttagtaaag
gaatttaacaagtatgacacagatgggtcaaagtggattaagcagtatactggaatcaat
gctatctctaagaaagaattttccattgatgttggttatgagagattcctgggacctgaa
atcttttttcatccagagtttgctaatccagactttacgcagcctatctcagaagttgta
gatgaagtaattcagaattgtcctattgatgttagacgtcctctctacaagaatattgtc
ctctctggaggttcaaccatgttcagggactttggacgtcgtttgcaaagagatttgaaa
agaactgtagatgccaggctgaagttgagtgaagaattgagtggcggtagattgaagcca
aaacctatcgacgtacaagttattacacaccacatgcaacgatatgcagtttggtttgga
ggatcgatgctggcttccacacctgagttctaccaagtatgccataccaaaaaggattat
gaagaaattggacctagcatttgtcgtcacaatccagtgtttggagtcatgtcgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100339213
Entry
100339213         CDS       T03373                                 
Symbol
ACTR2
Name
(RefSeq) ARP2 actin related protein 2 homolog
  KO
K17260  actin-related protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100339213 (ACTR2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100339213 (ACTR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100339213 (ACTR2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100339213 (ACTR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100339213 (ACTR2)
   05135 Yersinia infection
    100339213 (ACTR2)
   05100 Bacterial invasion of epithelial cells
    100339213 (ACTR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339213 (ACTR2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100339213 (ACTR2)
   04147 Exosome [BR:ocu04147]
    100339213 (ACTR2)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100339213 (ACTR2)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100339213 (ACTR2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100339213 (ACTR2)
  Exosomal proteins of other body fluids (saliva and urine)
   100339213 (ACTR2)
  Exosomal proteins of bladder cancer cells
   100339213 (ACTR2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100339213
NCBI-ProteinID: XP_002709882
Ensembl: ENSOCUG00000004906
UniProt: A0A5F9DJQ5
LinkDB
Position
2:complement(121011811..121067115)
AA seq 399 aa
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKNNKKMDL
MVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMN
PTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSL
PHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLAL
ETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRS
EFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVF
LGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggacagtcagggcaggaaggtggtggtgtgcgacaacggcaccgggtttgtgaagtgt
ggatatgcaggctctaattttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaagaataacaaaaagatggatcta
atggttggtgatgaggcaagtgaattacgctcaatgttagaagttaactatcctatggaa
aatggcatagtacggaattgggatgacatgaaacatctgtgggactatacatttggacca
gagaaacttaacatagataccagaaattgtaaaatcttacttacagaacctcctatgaac
ccaaccaaaaacagagaaaagattgtagaggtaatgttcgaaacttaccaattttctggt
gtgtatgtagccatccaggcagttctgactttatatgctcaaggtttactgactggtgtg
gtggtggactctggagatggtgtaactcacatttgcccagtgtatgaagggttttctctc
cctcacctcacgaggagactggatattgctgggagggatattaccagataccttatcaag
ctgcttctgttgcgaggatacgccttcaaccattctgctgatttcgaaacagttcgcatg
attaaagaaaaactgtgttatgttggatataatattgagcaagaacagaaactggcctta
gaaaccacagtattagttgaatcttatacactcccagatggacgcatcatcaaagtcggg
ggagagagatttgaagctccagaagctttatttcagcctcatttaatcaatgtggaggga
gttggtgttgctgaattgctttttaacacaattcaggcagctgacattgataccagatct
gaattctataagcacattgtgctttctggagggtctactatgtaccctggcctgccatcg
cggttggaaagagaacttaaacagctttacttggaaagagtgttaaagggagatgtggaa
aaactttctaaatttaagatccgcatcgaagacccaccccgcagaaagcacatggtgttc
ctgggtggtgcagttctagcagatatcatgaaagacaaagacaacttttggatgaccaga
caagaatatcaagaaaagggtgtccgtgtgctggagaaacttggtgtgactgtgcgataa

KEGG   Oryctolagus cuniculus (rabbit): 100343474
Entry
100343474         CDS       T03373                                 
Symbol
ACTR3B
Name
(RefSeq) ARP3 actin related protein 3 homolog B
  KO
K18584  actin-related protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100343474 (ACTR3B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100343474 (ACTR3B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100343474 (ACTR3B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100343474 (ACTR3B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100343474 (ACTR3B)
   05135 Yersinia infection
    100343474 (ACTR3B)
   05100 Bacterial invasion of epithelial cells
    100343474 (ACTR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100343474 (ACTR3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100343474 (ACTR3B)
   04147 Exosome [BR:ocu04147]
    100343474 (ACTR3B)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100343474 (ACTR3B)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100343474 (ACTR3B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100343474 (ACTR3B)
  Exosomal proteins of other body fluids (saliva and urine)
   100343474 (ACTR3B)
  Exosomal proteins of bladder cancer cells
   100343474 (ACTR3B)
SSDB
Motif
Pfam: Actin MreB_Mbl ALP_N KilA-N Robl_LC7
Other DBs
NCBI-GeneID: 100343474
NCBI-ProteinID: XP_008262149
Ensembl: ENSOCUG00000000459
UniProt: G1SDC1
LinkDB
Position
13:14087608..14207236
AA seq 418 aa
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDMDPRKWIKQYTGINAINQKKFIIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSEELSGGRIKP
KPVEVQVITHHMQRYAVWFGGSMLASTPEFFQVCHAKKDYEEYGPGICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggctccctgcctccctgcgtggtggactgtggcaccgggtataccaagcttggc
tacgcaggcaacactgagccacagttcattattccttcatgtattgccatcagggagtca
gcaaaggtagtcgaccaagcccaaaggagagtgttgaggggagttgatgaccttgatttt
ttcataggggatgaagccattgataaacctacatatgctaccaagtggcctatacgacat
ggaatcattgaagactgggatcttatggaaaggttcatggaacaggtagtttttaagtat
cttcgagctgaaccggaagaccattattttttaatgacagaacctccgctgaacacccca
gaaaatagagaatatcttgcagaaattatgtttgagtcatttaatgtcccaggactctac
attgcagttcaggcagtgctggccttagcagcgtcctggacatctcgacaagttggcgag
cgcacgttgacagggatagtcattgacagcggggacggcgtcacccatgtgatcccagtg
gcagaaggttatgtaattggaagctgcatcaaacacatcccgattgcaggtagagatatt
acatatttcattcaacagctgctaagggagagggaggtgggaatccctcctgagcagtca
ctggagaccgcaaaagccattaaggagaagtactgttacatttgcccggatattgtaaag
gaatttgctaagtatgacatggatccccggaagtggatcaaacaatacacgggtatcaat
gcaatcaatcagaagaagttcattatagatgttggttacgaaaggttcctgggacctgag
atattctttcacccagagtttgccaacccagacttcatggagtccatctcggatgttgtc
gatgaagtaatacaaaactgtcccattgatgtgcgacgcccgctgtataagaatgtcgtt
ctttcaggaggctccacaatgttcagggattttggacgtcgattgcagagagatttaaaa
agagtggtggacgccaggttaaaactaagtgaagagctgagtggcggcagaatcaagcct
aagcctgtggaggttcaggtgataacacatcatatgcagcgctatgccgtgtggtttgga
ggctcaatgctggcttccaccccggagttttttcaggtctgccatgccaagaaggactat
gaagagtacggccctggcatctgccgtcacaaccctgtcttcggagtcatgtcttag

KEGG   Oryctolagus cuniculus (rabbit): 100344359
Entry
100344359         CDS       T03373                                 
Symbol
ARPC5L
Name
(RefSeq) actin related protein 2/3 complex subunit 5 like
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344359 (ARPC5L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100344359 (ARPC5L)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100344359 (ARPC5L)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100344359 (ARPC5L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100344359 (ARPC5L)
   05135 Yersinia infection
    100344359 (ARPC5L)
   05100 Bacterial invasion of epithelial cells
    100344359 (ARPC5L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344359 (ARPC5L)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100344359 (ARPC5L)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100344359 (ARPC5L)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100344359 (ARPC5L)
SSDB
Motif
Pfam: P16-Arc Utp12
Other DBs
NCBI-GeneID: 100344359
NCBI-ProteinID: XP_002720498
Ensembl: ENSOCUG00000002997
UniProt: G1SIT6
LinkDB
Position
Un
AA seq 153 aa
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAGEPGPDPSEVDGLLRQGDMLRAFHAA
LRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPT
ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcccggaacaccctgtcttcgcgcttccgccgggtggatatcgacgagttcgacgag
aacaaattcgtggacgagcaggaggaggcggcggcggcggcgggagagccaggcccggac
cctagcgaggtggacgggctcctgcggcaaggggacatgcttcgggcgttccacgccgcc
ttgcggaactctccggtcaacaccaagaaccaggctgtgaaggagcgagcccagggcgtg
gtgctgaaggtgctcactaacttcaaaagcagcgaaattgagcaggcggtgcagtctctg
gacagaaacggcatcgacttgttaatgaagtacatttataaagggtttgagaagcccacg
gaaaacagcagtgcagtgctgcttcagtggcatgaaaaggccttagcagtaggaggacta
ggctccattattagagttcttacagcaagaaagactgtttaa

KEGG   Oryctolagus cuniculus (rabbit): 100346759
Entry
100346759         CDS       T03373                                 
Symbol
ARPC1B
Name
(RefSeq) actin related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346759 (ARPC1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100346759 (ARPC1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346759 (ARPC1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100346759 (ARPC1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346759 (ARPC1B)
   05135 Yersinia infection
    100346759 (ARPC1B)
   05100 Bacterial invasion of epithelial cells
    100346759 (ARPC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346759 (ARPC1B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100346759 (ARPC1B)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100346759 (ARPC1B)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100346759 (ARPC1B)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 100346759
NCBI-ProteinID: XP_008247154
Ensembl: ENSOCUG00000025962
LinkDB
Position
Un
AA seq 372 aa
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKNGAKWTKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATL
AYETLPLLAVTFITDNSLVAAGHDCFPVLFTYDSGAGTLSCGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGAAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcctaccacagcttcctggtggagcccatcagctgccacgcctggaacaaggaccgc
acccagatcgccatctgccccaacaaccacgaggtccacatctacgagaagaatggggcc
aagtggaccaaggtgcacgagctgaaggagcacaacgggcaggtgaccggcatcgactgg
gcccccgagagtaaccgcatcgtgacctgcggcacggaccgcaacgcctacgtgtggacg
ttgaaggggcgcacgtggaagcccacgctcgtcatcctgcgcatcaaccgggccgcccgc
tgcgtgcgctgggcccccaacgagaacaagttcgccgtgggcagcggctccagggtcatc
tccatctgctacttcgagcaggagaatgactggtgggtatgcaagcacatcaagaagccc
atccgctccaccgtcctcagcctggactggcaccccaacaacgtgctcctggcggccggc
tcctgcgacttcaagtgccggatcttctcggcctacatcaaggaggtggaggagcggccg
gcgcccaccccgtggggctccaagatgccctttggggagctgatgttcgagtccagcagc
agctgtggctgggtgcacggcgtctgcttctcggccagcggcagccgtgtggcgtgggtc
agccacgacagcaccgtgtgcctggctgatgctgacaagaagatggccgtggccaccctg
gcgtatgaaacgctgccgctgctggccgtcaccttcatcacggacaacagtctggtggcc
gcgggccacgactgcttcccggtgctgtttacctacgacagcggcgcggggacgctgagc
tgcggcgggcggctggacgtgcccaagcagagctcgcagcgcggcctcacggcccgcgag
cgcttccagaacctggacaagaaagccagctcggagggcggcgcggccgcgggggccggc
ctcgactcgctgcacaagaacagcgtcagccagatctcggtgctcagcgggggcaaggcc
aagtgttcgcagttctgcaccacgggcatggacggcggcatgagcatctgggacgtaaag
agcctggagtcggccttgaaggacctgaagatcaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100347020
Entry
100347020         CDS       T03373                                 
Symbol
ARPC1A
Name
(RefSeq) actin related protein 2/3 complex subunit 1A
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347020 (ARPC1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100347020 (ARPC1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347020 (ARPC1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100347020 (ARPC1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100347020 (ARPC1A)
   05135 Yersinia infection
    100347020 (ARPC1A)
   05100 Bacterial invasion of epithelial cells
    100347020 (ARPC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347020 (ARPC1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100347020 (ARPC1A)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100347020 (ARPC1A)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100347020 (ARPC1A)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 LytB_WW
Other DBs
NCBI-GeneID: 100347020
NCBI-ProteinID: XP_002721914
Ensembl: ENSOCUG00000003944
UniProt: G1SKS0
LinkDB
Position
Un
AA seq 370 aa
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtctctgcatcagtttttactagagccaatcacctgtcatgcctggaacagggatcgt
acccagatcgcccttagtcccaataaccacgaagtgcacatctacaagaagaacgggagc
cagtgggtgaaagctcatgaactcaaggagcacaacggacacatcacaggtatcgactgg
gctcccaagagcgaccgcattgtcacctgcggggcagaccgcaacgcctacgtgtggagt
caaaaggacggtgtctggaagccgaccctggtgatcctgcggattaaccgcgcagcgact
tttgtgaagtggtcgcccctagagaacaaatttgctgtgggaagtggagcgcggctcatt
tctgtttgttacttcgagtctgagaatgactggtgggtaagcaaacacattaaaaagcca
atacgctccacagtcctcagcctggactggcatccaaacaatgttttgctggcagcagga
tcgtgcgacttcaaatgcagggtgttttctgcctacattaaagaagtggatgaaaagcca
gccagtacaccctggggcagcaagatgcctttcggccagctgatgtcagagtttgggggc
agtggcactggcggctgggtccacggggtcagcttctctgccagtggaagccgcctggcc
tgggtcagccacgacagcaccgtatccgtggccgatgcctcaaaaagcgtgcaggtctcc
actctgaaaaccgagttcctgccgctcctcagtgtgtcctttgtctccgagaacagcgtc
gtggccgccggccatgactgctgcccgatgctgttcaactacgacgaccgcggctgcctg
acctttgtctccaagctggacattccgaaacagagcatccagcgcaacatgtccgccatg
gaacgcttccgcaacatggacaagagggccacgaccgaggaccgcaacacggccctggag
acgctgcaccagaacagcatcactcaagtgtctatttatgaggtggacaagcaagactgt
cgcaaattttgcacaactggcatcgatggagccatgacaatttgggatttcaagaccttg
gagtcgtccatccagggcctccggataatgtga

KEGG   Oryctolagus cuniculus (rabbit): 100349913
Entry
100349913         CDS       T03373                                 
Symbol
ARPC2
Name
(RefSeq) actin related protein 2/3 complex subunit 2
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349913 (ARPC2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100349913 (ARPC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100349913 (ARPC2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100349913 (ARPC2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100349913 (ARPC2)
   05135 Yersinia infection
    100349913 (ARPC2)
   05100 Bacterial invasion of epithelial cells
    100349913 (ARPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349913 (ARPC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100349913 (ARPC2)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100349913 (ARPC2)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100349913 (ARPC2)
SSDB
Motif
Pfam: P34-Arc ARPC4
Other DBs
NCBI-GeneID: 100349913
NCBI-ProteinID: XP_002712518
Ensembl: ENSOCUG00000005516
UniProt: A0A5F9CUC6
LinkDB
Position
7:159574832..159605403
AA seq 300 aa
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSIS
LKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKV
FMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNT
INLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
NT seq 903 nt   +upstreamnt  +downstreamnt
atgatcctgctggaggtgaacaaccgcatcatcgaggagacgctcgctctcaagttcgag
aacgcggccgccggaaacaaaccagaagcagtagaagtaacctttgcagattttgatgga
gtcctctatcatatttcaaatcctaatggagacaaaacaaaggtgatggtcagtatttct
ttgaaattctacaaagaacttcaggcacatggtgctgacgagttattaaaaagggtgtac
gggagtttcttggtgaatccagaatcaggatataatgtctctttgctatatgaccttgag
aatctgcctgcatccaaggattccattgtacatcaagctggcatgttgaagcggaactgt
tttgcctctgtctttgagaaatacttccagttccaagaagaaggaaaagaaggcgagaac
agggcagttatccattatagggatgatgagaccatgtatgttgagtctaaaaaggacaga
gtcaccgtagtcttcagcaccgtgtttaaggatgacgatgacgtggtcattggaaaggtg
ttcatgcaggagttcaaagaaggacgcagagccagtcacacagccccccaggtcctcttt
agccacagggaacctcctctggagctgaaagacacggatgctgctgtgggcgacaacatc
ggctacatcaccttcgtgctgttccctcgccacaccaacgccagtgcccgagataacacc
atcaacctgatccacacgttccgggactacctgcactaccacatcaagtgctctaaggcc
tatattcacacacgtatgcgggcaaaaacgtctgacttcctcaaggtgctgaaccgtgcg
cgcccagatgctgagaagaaagaaatgaaaacaatcacggggaagacgttttcatcccgc
taa

KEGG   Oryctolagus cuniculus (rabbit): 100357607
Entry
100357607         CDS       T03373                                 
Symbol
ARPC3
Name
(RefSeq) actin related protein 2/3 complex subunit 3
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100357607 (ARPC3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100357607 (ARPC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100357607 (ARPC3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100357607 (ARPC3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100357607 (ARPC3)
   05135 Yersinia infection
    100357607 (ARPC3)
   05100 Bacterial invasion of epithelial cells
    100357607 (ARPC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100357607 (ARPC3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100357607 (ARPC3)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100357607 (ARPC3)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100357607 (ARPC3)
SSDB
Motif
Pfam: P21-Arc
Other DBs
NCBI-GeneID: 100357607
NCBI-ProteinID: XP_008270436
Ensembl: ENSOCUG00000011908
UniProt: G1T277
LinkDB
Position
21:complement(6749671..6762561)
AA seq 178 aa
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccggcgtatcactcttccctcatggaccctgacaccaagctcatcggaaacatggca
ctgttacctatcagaagtcagttcaaaggccctgcccctagagagacaaaagatacggat
attgtggatgaagccatctattacttcaaggccaatgtcttcttcaaaaactatgaaatt
aagaatgaagccgacaggaccctgatatatataactctctacatctccgagtgtctaaag
aaactccaaaagtgcaattccaaaagccaaggcgagaaagaaatgtatacactgggaatc
acaaattttcccattcctggagagccaggatttccacttaatgcaatttatgccaaacct
gcaaacaagcaggaagatgaggtgatgcgcgcctacttgcagcagctaaggcaggagact
ggactgagactttgtgagaaagtttttgaccctcagaatgacaagcccagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagcctctcgggaccggggcagtga

KEGG   Oryctolagus cuniculus (rabbit): 100358336
Entry
100358336         CDS       T03373                                 
Name
(RefSeq) actin-related protein 3-like
  KO
K18584  actin-related protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358336
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100358336
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100358336
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100358336
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100358336
   05135 Yersinia infection
    100358336
   05100 Bacterial invasion of epithelial cells
    100358336
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358336
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100358336
   04147 Exosome [BR:ocu04147]
    100358336
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100358336
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100358336
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100358336
  Exosomal proteins of other body fluids (saliva and urine)
   100358336
  Exosomal proteins of bladder cancer cells
   100358336
SSDB
Motif
Pfam: Actin MreB_Mbl ALP_N Robl_LC7
Other DBs
NCBI-GeneID: 100358336
NCBI-ProteinID: XP_008254125
Ensembl: ENSOCUG00000024677
LinkDB
Position
3:145016457..145018751
AA seq 418 aa
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPSEQSLETAKAVKESYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCSIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggacggctgccggcctgtgtggtggactgtggcacggggtatacaaaactagga
tatgctggaaatacagaaccacagtttatcatcccttcctgtattgctattaaggagtca
gcaaaagtgggtgatcaagctcaaaggagggtgatgaaaggtgttgatgacctagacttc
ttcattggtgatgaagcaatagaaaaacctacatatgcaacaaagtggccaattcgccat
ggtatagttgaagattgggatttgatggaaaggtttatggaacaagtgatctttaaatat
ttaagggcagaacctgaagaccattattttcttttgactgaacctccactgaatactcca
gaaaacagggaatatactgctgaaataatgtttgagtctttcaatgttccaggcttgtac
attgctgtacaggctgttcttgccttagcggcatcctggacctcaagacaagtaggagaa
cggacattgactggtacggtaatagacagtggagatggtgtcactcatgtcattcctgtg
gctgaagggtatgtgattggcagctgtattaaacacattccaatcgcaggacgagatata
acatactttattcagcaactgctgagagaccgagaagtaggaatcccttcagaacaatcc
ctggaaactgctaaggcagtaaaggagagctatagttatgtctgcccagatttagtaaag
gaatttaacaagtatgacacagatgggtcaaagtggattaagcagtatactggaatcaat
gctatctctaagaaagaattttccattgatgttggttatgagagattcctgggacctgaa
atcttttttcatccagagtttgctaatccagactttacgcagcctatctcagaagttgta
gatgaagtaattcagaattgttctattgatgttagacgtcctctctacaagaatattgtc
ctctctggaggttcaaccatgttcagggactttggacgtcgtttgcaaagagatttgaaa
agaactgtagatgccaggctgaagttgagtgaagaattgagtggcggtagattgaagcca
aaacctatcgacgtacaagttattacacaccacatgcaacgatatgcagtttggtttgga
ggatcgatgctggcttctacacctgagttctaccaagtatgccataccaaaaaggattat
gaagaaattggacctagcatttgtcgtcacaatccagtgtttggagtcatgtcgtaa

KEGG   Oryctolagus cuniculus (rabbit): 103345506
Entry
103345506         CDS       T03373                                 
Symbol
ARPC4
Name
(RefSeq) actin related protein 2/3 complex subunit 4
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103345506 (ARPC4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103345506 (ARPC4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103345506 (ARPC4)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103345506 (ARPC4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103345506 (ARPC4)
   05135 Yersinia infection
    103345506 (ARPC4)
   05100 Bacterial invasion of epithelial cells
    103345506 (ARPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103345506 (ARPC4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    103345506 (ARPC4)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    103345506 (ARPC4)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     103345506 (ARPC4)
SSDB
Motif
Pfam: ARPC4 Sm_like Cmr7A
Other DBs
NCBI-GeneID: 103345506
NCBI-ProteinID: XP_008248167
Ensembl: ENSOCUG00000026353
LinkDB
Position
Un
AA seq 168 aa
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKER
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 507 nt   +upstreamnt  +downstreamnt
atgactgccactcttcgcccctacctgagtgccgtgcgggccacgctgcaggctgccctg
tgcctggaaaatttctcttcgcaggtcgtggaacgacacaataagccggaggtggaagtc
aggagtagcaaagagctgctgttgcaaccagttaccatcagcaggaatgagaaggagagg
gtgctgatcgagggctccatcaattccgtgcgggtcagcattgctgtgaagcaggccgac
gagatagagaagattctgtgccacaagttcatgcgtttcatgatgatgcgagcggagaac
ttcttcatccttcggaggaaaccagtggagggatacgacatcagtttcctgatcaccaac
ttccacacagagcagatgtacaagcacaagttggtagactttgtgatccacttcatggag
gagatcgacaaggagatcagcgagatgaagctgtcggtcaacgcccgcgcgcgcatcgtg
gcggaggagttcctcaagaacttttaa

KEGG   Oryctolagus cuniculus (rabbit): 103346289
Entry
103346289         CDS       T03373                                 
Symbol
ARPC5
Name
(RefSeq) actin related protein 2/3 complex subunit 5
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04666  Fc gamma R-mediated phagocytosis
ocu04810  Regulation of actin cytoskeleton
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103346289 (ARPC5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103346289 (ARPC5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103346289 (ARPC5)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103346289 (ARPC5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103346289 (ARPC5)
   05135 Yersinia infection
    103346289 (ARPC5)
   05100 Bacterial invasion of epithelial cells
    103346289 (ARPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103346289 (ARPC5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    103346289 (ARPC5)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    103346289 (ARPC5)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     103346289 (ARPC5)
SSDB
Motif
Pfam: P16-Arc
Other DBs
NCBI-GeneID: 103346289
NCBI-ProteinID: XP_008250403
Ensembl: ENSOCUG00000021558
LinkDB
Position
Un
AA seq 101 aa
MTAALQAALKNPPINTRSQAVKDRAGSIVLKVLISFKAGDIEKAVQSLDRNGVDLLMKYI
YKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacagccgccctgcaggcggcgctgaagaaccctcccatcaacaccaggagccaggcg
gtgaaggaccgggcaggcagcatcgtgctgaaggtgctcatctccttcaaggccggcgac
atagaaaaggccgtgcagtccctggacaggaacggcgtggacctgctcatgaagtacatc
tacaagggcttcgagagcccctccgacaacagcagcgccgtgctcctgcagtggcacgag
aaggcgctggctgcaggaggagtgggctccatcgtccgtgtcctgactgcaaggaaaacc
gtgtag

DBGET integrated database retrieval system