KEGG   Oryctolagus cuniculus (rabbit): 100008806
Entry
100008806         CDS       T03373                                 
Symbol
EGFR
Name
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu05160  Hepatitis C
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008806 (EGFR)
   04012 ErbB signaling pathway
    100008806 (EGFR)
   04014 Ras signaling pathway
    100008806 (EGFR)
   04015 Rap1 signaling pathway
    100008806 (EGFR)
   04630 JAK-STAT signaling pathway
    100008806 (EGFR)
   04066 HIF-1 signaling pathway
    100008806 (EGFR)
   04068 FoxO signaling pathway
    100008806 (EGFR)
   04020 Calcium signaling pathway
    100008806 (EGFR)
   04072 Phospholipase D signaling pathway
    100008806 (EGFR)
   04151 PI3K-Akt signaling pathway
    100008806 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100008806 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008806 (EGFR)
   04520 Adherens junction
    100008806 (EGFR)
   04540 Gap junction
    100008806 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100008806 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100008806 (EGFR)
   04915 Estrogen signaling pathway
    100008806 (EGFR)
   04921 Oxytocin signaling pathway
    100008806 (EGFR)
   04926 Relaxin signaling pathway
    100008806 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100008806 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008806 (EGFR)
   05206 MicroRNAs in cancer
    100008806 (EGFR)
   05205 Proteoglycans in cancer
    100008806 (EGFR)
   05207 Chemical carcinogenesis - receptor activation
    100008806 (EGFR)
   05208 Chemical carcinogenesis - reactive oxygen species
    100008806 (EGFR)
   05230 Central carbon metabolism in cancer
    100008806 (EGFR)
   05231 Choline metabolism in cancer
    100008806 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008806 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008806 (EGFR)
   05212 Pancreatic cancer
    100008806 (EGFR)
   05225 Hepatocellular carcinoma
    100008806 (EGFR)
   05226 Gastric cancer
    100008806 (EGFR)
   05214 Glioma
    100008806 (EGFR)
   05218 Melanoma
    100008806 (EGFR)
   05219 Bladder cancer
    100008806 (EGFR)
   05215 Prostate cancer
    100008806 (EGFR)
   05213 Endometrial cancer
    100008806 (EGFR)
   05224 Breast cancer
    100008806 (EGFR)
   05223 Non-small cell lung cancer
    100008806 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100008806 (EGFR)
   05171 Coronavirus disease - COVID-19
    100008806 (EGFR)
   05163 Human cytomegalovirus infection
    100008806 (EGFR)
   05165 Human papillomavirus infection
    100008806 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100008806 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100008806 (EGFR)
   01522 Endocrine resistance
    100008806 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100008806 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008806 (EGFR)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100008806 (EGFR)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100008806 (EGFR)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100008806 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100008806 (EGFR)
  Exosomal proteins of bladder cancer cells
   100008806 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH ABC1 Kdo
Other DBs
NCBI-GeneID: 100008806
NCBI-ProteinID: XP_008260065
Ensembl: ENSOCUG00000010481
LinkDB
Position
10:complement(45658882..45803851)
AA seq 1209 aa
MRPSGPVGPALLALLAALLQAGQALEEKRVCQGTSNKLTQLGPFEDHFLSLQRMFNSCEV
VLGNLEITYVQRNHDLSFLKTIQEVAGYVLIALNTVESIPLESLQIIRGNVLYENTYALA
VLSNYGANKTGLRELPMRNLQEILHGAVRFSNNPVLCNVETIQWRDIVHGDFLSNMSLDM
QNPLGSCQKCDPSCPNGSCWGAGGENCQRLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTRTPPLDPEELDILKTVREITGFLLIQAWPENKTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLQEISDGDVIVSGNRDLCYANTINWKKL
FGTSSQKTKIINNRGDKDCKAAGHVCDPLCSSEGCWGPEPRDCVSCRNVSRGKECVERCN
VLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIKCAHFIDGPHCVKTCPAGVM
GENDTLVWKFADAGRICRLCHPNCTYGCAGPGLEGCATNGPKIPSIATGVVGGLFLLVVL
GLGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKLKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLVTQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEIASVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIVEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMGDVIDADEYLIPQ
QGFFNSPSTSRTPLLSSLSATSNSSTMACVDRNGQSCPVKEDSLLQRYSSDPTGGVTEDS
MDDTFLPVPEYINQYIPKRPAGSVQNPVYHNQPLHPAPGRDPHYQDPHSSAVGNPEYLNT
TQPPCPNGIFDSPTPWAQKGSHQMSLDNPDYQQDFFPKDGKLNGIFKGPTAENAEYLRVA
PPGREFTTA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgaccctcggggccggtcgggcccgcgctcctggcgctgctggccgcgctcctgcag
gcgggacaggcgctggaggagaagagagtttgccagggcacaagcaacaagctgacccag
ctgggcccttttgaggaccacttcctgagcctgcagaggatgttcaacagctgtgaggtg
gtgctggggaacctggagatcacctacgtgcagaggaaccacgacctctccttcttaaag
accatccaggaggtggctggctacgtgctcattgccctcaacaccgtggagagcatccct
ttggagagcctgcaaatcatccgaggaaacgtgctgtatgagaacacctacgccttagcc
gttctgtccaactacggagccaacaagaccgggctgagggagctgcccatgcggaacttg
caggaaatccttcatggagctgtgcgattcagcaacaaccctgtcctgtgcaatgtggag
accatccagtggcgggacattgttcacggtgactttctgagcaacatgtctctggacatg
cagaaccccctgggcagctgccagaagtgtgacccaagctgtcccaatggaagctgctgg
ggcgcaggcggcgagaactgccagagactgaccaaaatcatctgcgcccagcagtgctct
ggacgctgccgcggcaagtcccccagcgactgctgccacaaccagtgtgctgctggctgc
acaggcccacgggagagcgactgcttggtctgccgtaaattcagagacgaagccacatgc
aaggacacctgcccacctctcatgctgtacaaccccaccacatatcagatggatgtcaac
cccgagggaaaatacagctttggtgccacctgtgtcaagaaatgtccccgtaactacgtg
gtgacagatcatggctcctgtgtccgggcctgtggtcctgacagctacgaggtggaggaa
gatggcgtccgcaagtgtaagaagtgcgaggggccttgtcgcaaagtttgtaatgggata
ggaattggtgaatttaaagacacgttgtccataaatgccacaaacatcaaacacttcaaa
aactgcacgtccatcagtggtgatctgcacatcctgccggtggcattcaggggggattcc
ttcacccgcaccccgcccctggaccccgaggagctggacatcctgaaaaccgtgcgggag
atcacagggtttctactgattcaggcgtggccagaaaacaagactgacctccatgccttt
gagaacctagaaatcatccgtggcaggacaaagcagcatggtcagttttctcttgcggtt
gtcggcctggacataacatccctgggactgcgctccctccaagagattagcgatggagac
gtgatcgtttcaggaaaccgagacctgtgctatgcaaacacaataaactggaaaaagctt
tttggaacctccagccagaaaaccaaaattatcaacaaccggggagacaaggactgcaag
gccgctggccacgtctgtgacccgctgtgctcatcggagggctgctggggccccgagccc
agggactgtgtctcctgccggaatgtcagccgtggcaaggagtgtgtggagaggtgcaac
gttctggagggtgagcccagggagtttgtggagaactctgagtgcattcagtgccatccg
gaatgtctgccccaggccatgaacatcacctgcacaggacggggtccagataactgcatc
aagtgtgcacacttcatcgatggccctcactgcgtcaagacctgcccagcaggagtcatg
ggggaaaacgacaccctggtctggaagtttgccgacgctggacgcatctgccgcctgtgc
cacccaaactgcacctatggctgtgctgggccaggtctcgaaggctgtgcaacaaatggg
cccaaaatcccctccatcgccacgggggtcgtgggcggcctcttcctgctggtggtgctg
ggcctcggcatcggcctcttcatgcgcaggcgccacattgtccggaagcgcacattgcgc
cgactgctgcaggagagagagctcgtggagcctcttacacccagtggggaggcccccaac
caagccctcctgaggattttaaaggaaacagaattcaagaagctcaaagtcctgggctct
ggagcgtttggcaccgtgtataagggactctggattccagaaggcgagaaagttaaaatc
cctgtggccatcaaggagttaagagaagccacgtctccaaaggccaacaaggagatcctg
gatgaggcctacgtgatggccagcgtggacaacccccatgtgtgtcgcctcctgggcatc
tgcctgacctccactgtgcagctcgtcacacagctcatgcccttcggttgcctgctggac
tacgtccgagagcacaaagacaacatcggctcccagcacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacctggaggaccggcgtctggtgcaccgcgacctggctgcc
aggaatgtgctggtaaagacaccgcaacacgtcaagatcacagattttgggctggccaag
ctgctcggtgcagaggagaaagaataccatgcagaggggggcaaggtccccatcaagtgg
atggctttggaatcgattttacaccggatttacacccaccagagtgatgtctggagctac
ggagtcaccgtttgggagttgatgacctttgggtccaagccttacgacggaatccctgcc
agtgagatcgcgtctgtgctggagaaaggagaacgacttccacagccccccatctgcact
attgacgtctacatgatcatggtcaagtgctggatgatagatgctgacagtcgcccaaag
ttccgggagttgattgtggaattttccaaaatggcccgagaccctcagcgttaccttgtc
attcagggggatgagcggatgcatttgccaagccctacagattccaatttttaccgtgcc
ctgatggacgaagaagacatgggcgacgtcatagatgctgacgagtacctcattcctcag
cagggcttcttcaacagcccctccacatcacggacgccgctcttaagctctctgagtgcg
accagcaacagttccaccatggcttgtgtggataggaacgggcagagctgtcctgtcaag
gaagacagcctcctgcagcggtacagctcagaccccactggtggcgtgactgaggacagc
atggatgacacgtttctcccagtgcctgaatacataaaccagtacattcccaagaggcct
gcaggctctgtgcagaaccctgtctaccataaccagcctctgcacccggctccgggcaga
gacccccactaccaggatccccacagcagcgcagtgggaaaccctgaatatctcaacacc
acccagcctccctgtcccaatggcatctttgacagccccaccccctgggcccagaagggc
agccaccaaatgagcctggacaaccccgattaccagcaagacttttttcccaaggatggc
aagctgaatggcatcttcaagggtcctacggctgaaaacgcagaatacctaagggtagca
ccaccaggccgtgaatttaccacagcgtga

KEGG   Oryctolagus cuniculus (rabbit): 100009417
Entry
100009417         CDS       T03373                                 
Symbol
FGFR2
Name
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04810  Regulation of actin cytoskeleton
ocu05200  Pathways in cancer
ocu05215  Prostate cancer
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009417 (FGFR2)
   04014 Ras signaling pathway
    100009417 (FGFR2)
   04015 Rap1 signaling pathway
    100009417 (FGFR2)
   04020 Calcium signaling pathway
    100009417 (FGFR2)
   04151 PI3K-Akt signaling pathway
    100009417 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100009417 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009417 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009417 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009417 (FGFR2)
   05230 Central carbon metabolism in cancer
    100009417 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100009417 (FGFR2)
   05215 Prostate cancer
    100009417 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100009417 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009417 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100009417 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009417 (FGFR2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100009417 (FGFR2)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100009417 (FGFR2)
CD molecules [BR:ocu04090]
 Proteins
  100009417 (FGFR2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100009417 (FGFR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set Ig_5 ABC1 C2-set_2 Kinase-like Pkinase_fungal FAM176
Other DBs
NCBI-GeneID: 100009417
NCBI-ProteinID: NP_001076157
Ensembl: ENSOCUG00000007069
UniProt: Q9TTZ3
LinkDB
Position
18:complement(68468508..68572816)
AA seq 782 aa
MVGWGRFICLVMVTMATVSLARPSFNLVEDATVEPEEPPTKYQISQPEVYVAAPGESLEL
RCLLKDASVISWTKDGVHLGPNNRTVLIGEYLQIRGATPRDSGLYACTAARTVDSDTWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNSKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGSPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPVREKEITASPDYLEIAIYCIGVFLIVCMVITVIVCRMKTTSKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSAADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEPYS
PS
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggtcggctggggccgcttcatctgcctggtcatggtcaccatggcaaccgtgtccctg
gccaggccctccttcaatttggttgaggacgccacggtggagccggaagagccaccaacc
aaataccaaatctctcaaccggaagtgtacgtggccgcgccaggggagtcgctagagttg
cgctgcctgttgaaagatgcctccgtgatcagttggactaaggatggggtgcacttgggg
cccaacaataggacagtgcttattggggagtacttgcagataagaggcgccacgcctagg
gactccggcctctatgcttgtactgctgctaggactgtagacagtgacacttggtacttc
atggtgaatgtcacagatgccatctcttctggagatgacgaggacgacacggacggcgcc
gaagactttgtcagtgagaacagtaacagcaagagagcgccctactggaccaacacggag
aagatggagaaacgcctgcacgccgtcccggccgccaacaccgttaagttccgctgcccg
gcgggggggagcccgacccccaccatgcggtggctcaagaacgggaaggagtttaagcag
gagcatcgcatcggaggctataaggtgcgaaaccagcactggagccttatcatggagagc
gtggtcccttccgacaaaggcaattatacgtgcgtggtggagaacgagtacgggtccatc
aaccacacctaccacctcgacgtcgtggagcggtctccgcaccggcccatcctccaggcg
gggctgccggccaatgcctccacggtggtgggaggtgacgtggagtttgtgtgcaaggtg
tacagtgacgcacagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaa
tacgggcccgacgggctgccctacctcaaggtactcaaggctgccggtgttaacaccacg
gacaaagaaattgaggttctctatattcggaatgtaacttttgaggatgctggggagtat
acgtgcttggcgggtaattctattgggatatcctttcactctgcatggttgacagttctg
ccagctcccgtaagagaaaaggagattacagcctccccagactacctggagatagccatt
tactgcataggggtcttcctgatcgtgtgcatggtgatcaccgtcatcgtgtgccgcatg
aagaccaccagcaagaagccggacttcagcagccagccggcggtgcacaagctgaccaag
cgcatccccctgcggagacaggtaacagtctcggccgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacgacgcgcctgtcctccgccgcagacacccccatgctg
gcgggcgtctctgagtacgagctgccggaggaccccaaatgggagttccccagagacaag
ctgacgctgggcaaacccctgggagaaggttgctttgggcaagtggtcatggccgaagct
gtgggaattgacaaagacaagcccaaggaggcagtcactgtggcggtgaaaatgttgaaa
gatgacgccacggaaaaggacctttcggatctggtctcggagatggagatgatgaagatg
atcggaaaacacaagaacatcatcaatcttcttggcgcctgtacgcaggatgggccgctg
tacgtcctggttgagtacgcctccaagggcaacctgcgcgagtacctgcgagcccgcagg
ccgcccggcatggagtactcctacgacatcaaccgggtgcccgaagaacagatgaccttc
aaggacctggtgtcgtgcacctaccagctggccaggggcatggagtacttggcttcccag
aagtgtattcaccgggatttagcagccagaaacgttttggtcacggagaacaatgtgatg
aaaatagcagacttcggactggccagagatatcaacaacatcgactattacaagaaaacc
accaatggtcgacttccagtcaagtggatggctccggaagccctgttcgatcgggtgtac
actcaccagagtgatgtctggtctttcggggtgttaatgtgggagatcttcacgttaggg
ggctcgccctacccaggcattcccgtggaggaactcttcaagctgctcaaggaaggacat
aggatggacaagccggccaactgcaccaacgagctgtatatgatgatgagagactgctgg
cacgcggtgccctcacagagacccacgttcaagcagttggtggaagacttggatcgcatt
ctcactctgacaaccaacgaggagtacttggacctcagccagcctctcgagccatactca
cctagttag

KEGG   Oryctolagus cuniculus (rabbit): 100144342
Entry
100144342         CDS       T03373                                 
Symbol
IGF1R
Name
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04144  Endocytosis
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04730  Long-term depression
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100144342 (IGF1R)
   04014 Ras signaling pathway
    100144342 (IGF1R)
   04015 Rap1 signaling pathway
    100144342 (IGF1R)
   04066 HIF-1 signaling pathway
    100144342 (IGF1R)
   04068 FoxO signaling pathway
    100144342 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100144342 (IGF1R)
   04152 AMPK signaling pathway
    100144342 (IGF1R)
   04150 mTOR signaling pathway
    100144342 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100144342 (IGF1R)
   04140 Autophagy - animal
    100144342 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100144342 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100144342 (IGF1R)
   04520 Adherens junction
    100144342 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100144342 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100144342 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100144342 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100144342 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100144342 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100144342 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100144342 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100144342 (IGF1R)
   05205 Proteoglycans in cancer
    100144342 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100144342 (IGF1R)
   05214 Glioma
    100144342 (IGF1R)
   05218 Melanoma
    100144342 (IGF1R)
   05215 Prostate cancer
    100144342 (IGF1R)
   05224 Breast cancer
    100144342 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100144342 (IGF1R)
   01522 Endocrine resistance
    100144342 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100144342 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100144342 (IGF1R)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100144342 (IGF1R)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100144342 (IGF1R)
CD molecules [BR:ocu04090]
 Proteins
  100144342 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 Insulin_TMD
Other DBs
NCBI-GeneID: 100144342
NCBI-ProteinID: XP_008247008
Ensembl: ENSOCUG00000014795
UniProt: G1TLR2
LinkDB
Position
Un
AA seq 1366 aa
MKSGSGGGSRTSAWGLLFLSAALSVWPTSGEICGPGIDIRNDFQQLKRLENCTVIEGFLH
ILLISKAEDYRNYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKSPKECGD
MCPGTLEEKPLCEKTAINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCH
APDDDTACVACRHYYFSGVCVPACPPNTYRFEGWRCVDRDFCANIPNADGGDSEGFVIHD
GECMQECPSGFIRNGSQSMFCIPCEGPCPKVCEEDKKTKTIDSVNSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKISHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEDVTGTKGRQSKGDINTR
NNGERASCESDILHFTSTNTWKNRIILTWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDLEPGILLQGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDILSASNSSSQLIVKWSPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKEDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERKRRDVAQVANTTLSGRGRNGTAVDMYNSTDLEELETEYPFFE
TRVDKEITVISNLRPFTSYRIDIHSCNHEAEKLGCSASNFVFARTKPAEGADDIPGPVTW
EARPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRECVSRQQYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTEPVFFYVPAKATYESFMHLIIALPVAILLIVGGLLIVLYVFHR
KRSNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEVENRAPAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNC
MVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVV
LWEIATLAEQPYQGFSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLE
IIGSVRDEMEPGFREVSFYYSEENKPPEAEELDLEPENMESVPLDPSANAAAAVAALQPD
RHKAENGPSAGAMVLRASFDERRPYAHMNGGRTDERALPLPQSSTC
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtcccggacctcggcgtgggggctcctgtttctctcc
gccgcgctctcggtctggccgacgagtggagaaatctgcgggccgggcatcgacatccgc
aatgacttccagcagctgaagcgcctggagaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgcaactaccgcttccccaagctcaccgtc
atcaccgagtacctgctgctgttccgcgtggccggcctggagagcctcggggacctgttc
cccaacctcacggtcatccgcggctggaagctcttctacaactatgccctggtcattttc
gagatgactaacctcaaagacatagggctctataacctgaggaacatcacccggggggcc
atcaggatcgagaagaacgccgacctctgctacctctccacggtggactggtctctcatc
ctggacgccgtgtccaacaactacattgtggggaacaagtccccaaaggagtgcggggac
atgtgtccagggaccttggaggagaagccgttgtgcgagaagaccgccatcaacaacgag
tacaactaccgctgctggaccaccaaccgctgccagaaaatgtgccccagcgcgtgcggg
aagcgggcatgcaccgagaacaacgaatgctgccaccccgagtgcctgggcagctgccac
gcgcctgacgacgacacggcctgcgtcgcctgccgccactactatttctccggcgtctgc
gtgcccgcctgcccgcccaacacctaccgattcgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccctaacgccgatggcggcgactccgagggctttgtcatccacgac
ggcgagtgcatgcaggagtgcccgtcgggcttcatccgcaacggcagccagagcatgttc
tgcattccctgtgaaggtccgtgccccaaggtctgtgaggaagacaagaaaacaaagacc
attgattctgttaattctgctcaaatgctccaaggctgcaccatcttcaaggggaatctg
ctcattaacatccgacgaggcaataacattgcctcggagctggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatcagccactcgcacgccttggtctccttgtcc
ttcctgaagaacctccgccagatcctaggggaggagcagctggaagggaactactccttc
tacgtcctggacaaccagaacttgcagcagctctgggactgggaccaccgcaacctgacc
atcaaagctgggaagatgtacttcgccttcaaccccaaactgtgcgtgtcggaaatttac
cgcatggaggacgtgacggggacgaaaggacgccagagcaagggcgacataaacaccagg
aacaacggggagagagcctcctgtgagagcgacatcctgcatttcacctccaccaacacg
tggaagaaccgcatcatcctaacctggcaccgctaccgcccccctgactacagggatctc
atcagcttcaccgtctactacaaggaggcaccctttaaaaatgtgacggagtatgatggg
caggacgcctgcggctccaacagctggaacatggtggacgtggacctccctcccaacaag
gacctagagcctggtattctactgcaagggctgaagccctggactcagtacgccgtctac
gtcaaggccgtgaccctcaccatggtggagaatgaccacatccgaggggccaagagtgaa
atcttgtacattcgcaccaacgcctcagttccttccatccccttggacatcctctcggca
tccaactcctcgtctcagctgatcgtgaagtggagccccccgtccctgcccaacgggaac
ctgagctactacatcgtgaggtggcagcggcagccccaggacggctacctgtaccggcac
aactactgctccaaagaagacaaaattcccatcaggaagtatgcggacggcaccatcgac
gtggaggaggtgacggagaaccccaagacggaggtctgtggcggagagaaggggccttgc
tgcgcgtgccccaagaccgaagccgagaagcaggctgagaaggaggaggcggagtaccgc
aaggtgttcgagaacttcctgcacaactccatcttcgtgcccagacccgagaggaagcgg
agagatgtcgcccaggtggccaacaccacgctgtccggccgaggcaggaacggcacggcg
gtggacatgtacaacagcacggacctggaggagctggagacagaataccctttctttgag
accagagtggacaaggagataacggtcatatctaacctgcggccgtttacttcctaccgc
atcgatatccacagctgcaaccacgaggcggagaagctggggtgcagtgcctccaacttt
gtctttgcgagaaccaagcctgcagaaggagcggatgacattccgggccctgtgacctgg
gaagcaaggcctgaaaactccatctttctgaagtggccggaacctgagaaccccaacgga
ttgatcctaatgtatgagataaaatacgggtctcagatcgaggaccagagggaatgtgtg
tccagacagcagtaccgaaagtatggaggagccaagctcaaccggctaaacccggggaac
tatacagcccggattcaggctacgtcgctctccgggaacgggtcgtggacggagcctgtg
ttcttctatgtcccagccaaagccacctacgagagcttcatgcacctgatcatcgcgctg
ccggtcgccatcctgctcatcgtgggagggctgctgatcgtgctgtacgtcttccacagg
aagagaagtaacagcagactggggaacggagtgctgtacgcctctgtgaacccggagtac
ttcagtgcagccgacgtatacgtccctgacgagtgggaggtggcgcgggagaagatcacc
atgagccgcgagcttggccagggctccttcgggatggtctacgaaggcgtcgccaagggc
gtggtaaaggatgagccggaaaccagggtggccatcaagacggtgaacgaggccgccagc
atgcgggagaggatcgagtttctcaacgaggcgtctgtgatgaaggagttcaattgtcac
cacgtggtgcggttgctgggggtggtgtcccagggccagcccaccctggtcatcatggag
ctgatgacgcgaggggacctcaagagctatctcaggtccctgcgaccggaagtggagaat
cgggccccagcccctccgagtctgagtaagatgatccaaatggccggggagattgcagat
ggcatggcatacctcaacgccaacaagttcgtgcacagagaccttgctgcccggaactgc
atggtggccgaggatttcacagtcaagatcggagatttcggaatgacgcgggacatctac
gagacggactactaccggaaaggggggaaaggcttgctgcccgtgcgctggatgtccccc
gagtccctcaaagatggagtcttcaccacccactctgacgtctggtccttcggagtcgtc
ctctgggagatcgccacgctggcagagcagccgtaccagggattctccaacgagcaggtc
ctgcgcttcgtcatggagggcggccttctggacaagccggacaactgccccgacatgctg
tttgagctgatgcgcatgtgttggcaatacaaccccaagatgcggccttccttcctggag
atcatcggcagtgtcagagacgagatggagcccggcttccgcgaggtctccttctactac
agcgaggagaacaagccgcccgaggccgaggagctcgacctggagcccgagaacatggag
agcgtgcccctggacccctccgcgaacgccgctgccgccgtcgccgccctgcagcccgac
aggcacaaggccgagaacggcccgagtgcaggggcgatggtcctgcgagccagctttgac
gagaggcgaccctacgcgcacatgaatgggggccgcacagacgagcgggccctgccgctg
ccgcagtcttcgacctgctga

KEGG   Oryctolagus cuniculus (rabbit): 100343006
Entry
100343006         CDS       T03373                                 
Symbol
PDGFRA
Name
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04630  JAK-STAT signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100343006 (PDGFRA)
   04014 Ras signaling pathway
    100343006 (PDGFRA)
   04015 Rap1 signaling pathway
    100343006 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100343006 (PDGFRA)
   04020 Calcium signaling pathway
    100343006 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100343006 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100343006 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100343006 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100343006 (PDGFRA)
   04540 Gap junction
    100343006 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100343006 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343006 (PDGFRA)
   05206 MicroRNAs in cancer
    100343006 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100343006 (PDGFRA)
   05231 Choline metabolism in cancer
    100343006 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100343006 (PDGFRA)
   05218 Melanoma
    100343006 (PDGFRA)
   05215 Prostate cancer
    100343006 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100343006 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100343006 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100343006 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100343006 (PDGFRA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100343006 (PDGFRA)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100343006 (PDGFRA)
CD molecules [BR:ocu04090]
 Proteins
  100343006 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 C2-set_2 Herpes_gE Kinase-like DUF3912 IpaB_EvcA ECSCR
Other DBs
NCBI-GeneID: 100343006
NCBI-ProteinID: XP_017193297
Ensembl: ENSOCUG00000000258
LinkDB
Position
Un
AA seq 1093 aa
MGPSPPAFLVLVLGWLLAGPSLTRCQLPLPSISPGDSERVVPLNSSFTLRCSGESEVSWQ
YPVSEDEGPRVDVRSEENNTGYFVAVLEVGSATAAHTGLYTCYYNHTQTEDSDVEGSHVY
IYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRNSQGLVPASYDSRHGF
NGTFTMGPYVCEATVRGKTVQTIPFNIYALKATSELDLEMEALQTVYKAGETIVVTCAVF
NNEVVDLQWTYPGEMKGKGVTMLEEIKVPTLKLVYTLTVPRATVKDSGDYECAARQATRE
VKEMKKVTIAVHEKGFVEIKPTFNQSEAVNLHEVKHFVVEVRAYPPPRISWLKDSRTLIE
NLTEITTDVEQVQETRYRCKLKLIRAKEEDSGHYTIVAENEDDVQSYTFELLTQVPASIL
DLVDDHHAPTGGQTVRCTAAGTPLPDVEWMICKDIKRCNNETSWTLLANNVSNIVTETHP
RGGGAVEGRVTFAKVEETLAVRCLARNPLGTENRELKLVAPTLRSELTVAAAVLVLLVVV
IVSLIILVVVWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRI
LGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIV
NLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTR
SYVILSFENNGDYMDMKQADGTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSALESEV
KNLLSDDNAEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFG
LARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPG
MMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGQY
KKSYEKIHLDFLRSDHPAVARMRVDTDSAYLGVTYKNEEDKLKDWEGGLDEQRLSADSGY
IIPLPDIDPVPEEDEEDGGKRNRHSSQTSEESAIETGSSSSTFMKREDETIEDMDMMDDI
GMDSSDLVEDSFL
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgggaccctcccctccggccttcctggtcctggtcctcggctggctcctggcagggccg
agcctcacgcgctgccagctcccgctaccctccatctcccccggcgacagcgagagggtg
gtgccgctgaactcctctttcaccctgcgctgctccggggagagtgaagtgagctggcag
taccccgtgtccgaggacgagggccccagggtggacgtcaggagcgaggagaacaacact
ggctattttgtggccgtgctggaggtgggcagtgccaccgcggcccacacgggcttgtac
acctgctactacaaccacacgcagacggaggacagcgacgtggaaggcagccacgtgtac
atctacgtgccggacccggacgtcgccttcgtgcccctggggatgaccgactacctggtc
atcgtggaggacgacgactcggccatcatcccgtgtcgcaccaccgaccccgagaccccc
gtcaccctgcgcaacagccagggcctggtgcccgcctcctacgacagccggcacggcttc
aacggcaccttcaccatggggccctacgtgtgtgaggccaccgtgcgcgggaagaccgtg
cagaccatccccttcaacatctacgccttgaaagcgacgtcggagttggatctggaaatg
gaagcgctccagactgtgtataaggcaggagagacgattgtggtcacctgcgccgtcttc
aacaacgaagtggtggacctgcagtggacttaccccggggagatgaagggcaaaggtgtc
acaatgctggaagaaatcaaagtccccacactcaagctggtgtacacgctgacggtcccc
agggccacagtgaaggacagcggggactatgagtgcgctgcccgccaggccaccagggag
gtcaaagagatgaagaaggtcaccatcgctgtgcatgagaaggggtttgtggagatcaag
cccactttcaaccagtcggaggccgtcaacctgcacgaagtgaagcatttcgtggtggag
gtgcgcgcctaccccccgcccaggatatcctggctgaaggacagccggactctgatcgag
aatctcacggagatcaccacggacgtggagcaggtgcaggagacgcggtatcgatgcaag
ttgaagctcattcgggccaaggaggaggacagcggccattacaccatcgtggctgagaat
gaagatgacgtccagagctacacgttcgagctcttaactcaagtgcccgcatccatcctg
gacttggtggatgaccaccacgcccccaccgggggacagacggtgaggtgcacggctgcg
ggcacgcctcttccggatgtcgaatggatgatctgcaaggatatcaagaggtgtaacaat
gaaacctcgtggacgcttttggccaacaacgtgtccaacatcgtcacggagacccacccc
cggggcgggggcgccgtggagggccgggtgaccttcgccaaggtggaggagacccttgcc
gtccgctgcctggccaggaatcctctgggcacggagaaccgcgagctgaagctggtggct
cccaccctgcgctcggaactcacggtggcggccgcggtactggtgctgctggtggttgtg
attgtctcgctcatcatcctggttgtcgtctggaagcagaaacccaggtacgagattcgc
tggcgggtcatcgagtccatcagccccgacggccatgaatacatttacgtggaccccatg
cagctgccgtacgactcgcgatgggagtttccgcgagatggcctcgtgctgggtcgcatc
ttgggatccggggcctttgggaaagtggtggaagggacagcctacggactgagccggtcc
cagccggtcatgaaggtggcggtaaagatgctgaaacccacggccaggtccagcgagaag
caggctctcatgtccgagctgaagatcatgacccacctggggccgcatctcaacattgtc
aacttgctgggagcctgtaccaagtcaggccccatttacatcatcaccgagtactgcttc
tatggggatttggtcaactatctgcataagaacagggacagcttcctgagccgccacccg
gagaagcccaagaaggagctggacatctttgggttgaaccctgcagatgaaagcacacgg
agctacgtgattctgtctttcgagaacaatggtgactacatggacatgaagcaggccgac
ggcacgcagtacgtccccatgctggagcggaaagaggtgtccaagtactcggacatccag
cgctcgctgtacgatcgcccggcttcctacaagaagaagtccgcgctagagtccgaagtc
aaaaacctcctttcggatgacaacgcggaaggcctcaccttgttggatctgttgagcttt
acctaccaagtcgctcgagggatggaatttttggcttcaaaaaattgcgtccaccgggac
ctggccgcgcgcaacgtgctcctggcgcaagggaagattgtcaagatctgtgacttcggc
ctggccagagacatcatgcacgactccaactacgtctccaaaggcagcaccttcctgccc
gtgaagtggatggcccccgagagcatcttcgacaacctctacaccacgctgagcgacgtg
tggtcctacggcatcctgctctgggagatcttctctctcgggggcacaccctaccctggc
atgatggtggactccaccttctacaacaagatcaaaagcggctaccggatggccaagcct
gaccacgccaccagtgaagtctacgagatcatggtgaagtgctggaacagcgagcccgag
aagcggccctccttttaccacctgagcgagatcgtggagagtctgctgcccggacagtat
aaaaagagctatgagaagatccacctggacttcctgaggagcgaccaccccgccgtggcg
cgcatgcgtgtggacaccgacagcgcgtacctgggcgtcacctacaagaacgaggaggac
aagctgaaggactgggagggcggcctggacgagcagaggctgagtgccgacagcggctac
atcatccccctgcccgacatcgaccccgtgcccgaggaggacgaggaggacgggggcaag
cgcaaccggcacagctcgcagacctcggaggagagtgccatcgagacgggttccagcagc
tccaccttcatgaagagagaggacgagaccatcgaggacatggacatgatggacgacatt
ggcatggactcctcggacctggtggaggacagcttcctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100355275
Entry
100355275         CDS       T03373                                 
Symbol
FGFR4
Name
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04810  Regulation of actin cytoskeleton
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100355275 (FGFR4)
   04014 Ras signaling pathway
    100355275 (FGFR4)
   04015 Rap1 signaling pathway
    100355275 (FGFR4)
   04020 Calcium signaling pathway
    100355275 (FGFR4)
   04151 PI3K-Akt signaling pathway
    100355275 (FGFR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355275 (FGFR4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100355275 (FGFR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100355275 (FGFR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355275 (FGFR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100355275 (FGFR4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100355275 (FGFR4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100355275 (FGFR4)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100355275 (FGFR4)
CD molecules [BR:ocu04090]
 Proteins
  100355275 (FGFR4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set Kinase-like C2-set_2 Pkinase_fungal
Other DBs
NCBI-GeneID: 100355275
NCBI-ProteinID: XP_002710465
Ensembl: ENSOCUG00000003380
LinkDB
Position
3:57624596..57634195
AA seq 801 aa
MWVLLALLGVLLGAPGAPALSLEASEEVELEPCPAPSLEQPEQELTVALGQPVRLCCRRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVLHNLTLAVDDS
SVSSDDPEDPKAHRGSPNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTIKFRCPAAGNPMP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENPLGSIRYSYLLD
VLERSPHRPILQAGLPANTTAVAGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA
ASPEARYTDIILYASGSLALAVLLLLAGLYRGQVLHGRRARQPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPPLLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGQHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPEGPRSSEGPLSFPALVSCAYQVARGM
QYLESQKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG
LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDTSSTCSSNDS
VFSHDPLPLGPSPFPFPGVQT
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgtgggtgctactggccctgctgggggtcctgctgggggcacctggggctccagccttg
tcccttgaggcttctgaggaagtggagctggaaccctgcccagcccccagcctggaacag
cccgagcaggaactgaccgtggcccttgggcagcccgtgcggctgtgctgcaggcgggct
gagcggggcggccactggtacaaggagggcagtcgcttagcacctgccggccgggtgcgg
ggctggaggggccgcctggagattgccagcttcctgcccgaggatgccggccgctacctc
tgcctggctcgaggctccatgacggtcctgcacaatctcaccttggctgtggatgactcc
tcggtctccagtgacgatcctgaggaccccaaggcccacaggggctccccgaacaggcac
agttaccctcagcaagctccatactggacacacccccagcgcatggagaagaaactgcat
gcagtgcctgccgggaacaccatcaagttccgctgcccagccgcaggcaaccccatgccc
accatccgctggctcaaggacggacaggccttccatggggagaaccgcattggagggatt
cggctgcgccaccaacactggagcctggtgatggaaagcgtggtgccctcggaccggggc
acgtacacctgcctggtggagaaccctctgggcagcatccgctacagctacctgctggat
gtgctggagcgctccccgcaccggcccatcctgcaggcggggctgccggccaacaccacg
gctgtggcgggcagtgacgtggagctgctgtgcaaggtgtacagtgatgcccagccccac
atccagtggctgaaacacatcgtcatcaacggcagcagctttggcgccgacggcttcccc
tatgtgcaagtgctgaagaccgcagacatcaacagctccgaagtggaagtcctgtacctg
cgaaacgtttcggccgaggacgcgggcgagtacacctgcctggccggcaactccatcggc
ctctcctaccagtcggcctggctcaccgtgctgccagaggaggaccccacatggacagca
gcctcacccgaggccaggtacacagacatcatcctgtatgcctctggctctctggctctg
gctgtgctcctgctgctggccgggttataccgagggcaggtgctccacggccggcgtgct
cggcagcccgccacggtgcagaagttgtcccgcttccctctggcccgacagttctctctg
gagtcgggctcctcaggcaagtcgagttcgtccctggtgcgaggcgtccggctctcctcc
agcggcccccccttgctcgctggcctcgtgagtctagacctccctctggacccgctgtgg
gagttcccccgggacaggttggtgcttgggaagccgctgggagagggctgcttcgggcag
gtggtgcgtgcagaggccttcggcatggaccctgcccgccctgaccaagctagcaccgtg
gccgtcaagatgctcaaggacaacgcctcagacaaggacctggccgacctggtgtctgag
atggaggtgatgaagctgataggccagcacaagaacatcatcaacctgctaggcgtctgc
acccaggaagggcccctgtacgtgattgtggaatgtgcggccaagggaaacttgcgggag
ttcctgcgggcccggcggcccccgggccccgacctcagccccgaaggaccgaggagcagt
gaggggccactgtccttcccggccctggtctcctgtgcctaccaggtggcgcgcggcatg
cagtacctggagtcgcagaagtgcatccaccgggacctggctgcccgcaacgtgctggtg
accgaggacaacgtgatgaaaatcgccgacttcgggctggcccgaggcgtccaccacatt
gactactacaagaaaaccagcaatggccgcctgcctgtcaagtggatggcccccgaggcc
ttgtttgaccgagtgtacacacaccagagtgatgtgtggtcatttgggatcctgctctgg
gagatcttcacacttgggggctccccgtaccccggcatccccgtggaggaactgttctca
ctgctgcgggagggccatcggatggaccggcccccacactgccccccagagctgtacggg
ctgatgcgcgagtgctggcacgcggcgccttcccagagacccaccttcaagcagctggta
gaagcgctggacaaggtgctgctggcggtctctgaggagtacctcgacctccgcctgacc
tttggaccctactccccctccggaggagacaccagcagcacctgttcctccaatgactct
gtcttcagtcacgaccccttaccattggggcccagccccttccccttccctggggtacag
acgtga

DBGET integrated database retrieval system