KEGG   Oryctolagus cuniculus (rabbit): 100008837
Entry
100008837         CDS       T03373                                 
Symbol
CAV1
Name
(RefSeq) caveolin 1, caveolae protein, 22kDa
  KO
K06278  caveolin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04510  Focal adhesion
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05205  Proteoglycans in cancer
ocu05416  Viral myocarditis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100008837 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008837 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100008837 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100008837 (CAV1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100008837 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100008837 (CAV1)
   05416 Viral myocarditis
    100008837 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008837 (CAV1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100008837 (CAV1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 100008837
NCBI-ProteinID: NP_001104542
Ensembl: ENSOCUG00000014520
UniProt: Q09YN6
LinkDB
Position
7:complement(28753340..28800840)
AA seq 178 aa
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNVRISMQKEI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactccgagggacatctctacactgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggccgacgaggtgaacgagaagcaa
gtgtacgacgcgcacaccaaggaaatcgacctggtcaaccgcgaccccaagcatctcaac
gacgacgtggtcaagatcgactttgaagatgtgattgcagaaccagaagggacacacagt
ttcgacggcatctggaaggccagcttcaccaccttcactgtgacgaaatactggttttac
cgcctactgtctaccatctttggcatcccaatggcactcatctggggcatttactttgcc
attctctctttcctgcacatctgggcagttgtgccttgcattaagagtttcctgattgag
attcagtgcatcagccgagtctattccatctacgtccacaccttctgtgatccactcttt
gaagctattggcaaaatattcagcaatgtccgcatcagtatgcagaaagaaatataa

KEGG   Oryctolagus cuniculus (rabbit): 100126563
Entry
100126563         CDS       T03373                                 
Symbol
CAV2
Name
(RefSeq) caveolin 2
  KO
K12958  caveolin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04510  Focal adhesion
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05205  Proteoglycans in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100126563 (CAV2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100126563 (CAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100126563 (CAV2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100126563 (CAV2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100126563 (CAV2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100126563 (CAV2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100126563 (CAV2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100126563 (CAV2)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 100126563
NCBI-ProteinID: NP_001164493
Ensembl: ENSOCUG00000014515
UniProt: Q09YN7
LinkDB
Position
7:complement(28818254..28826159)
AA seq 162 aa
MGLETEKADVQLFMDDDAYSHHSGVDFADPEKFPDTGPDRDPHGLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVLYKFLTVFLAIPLAFAAGVLFAVLSCLHIWILMPFVK
TCLMVLPSVQTIWRSVTDVVIAPLCASIGRSFSSVGLQLSHD
NT seq 489 nt   +upstreamnt  +downstreamnt
atggggctggagaccgagaaggcagacgtacagctcttcatggacgacgacgcctacagt
caccacagtggcgtcgacttcgccgaccccgagaagttcccggacactggcccggaccgt
gatccccacgggctcaactcgcatctcaagctaggctttgaggatgtgatcgccgagccg
gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc
aagtacgtgctgtacaagttcctgacggtattcctggccatccccctggccttcgccgcg
ggagttctctttgccgtcctcagctgtctacacatctggattttgatgcctttcgtaaag
acctgcttaatggtcctgccttcagtgcagacgatatggaggagtgtgacagatgttgtc
attgcgccactgtgtgcaagcataggacgaagcttctcttccgtcggcttgcagctgagt
cacgactga

KEGG   Oryctolagus cuniculus (rabbit): 100342999
Entry
100342999         CDS       T03373                                 
Symbol
CAV3
Name
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04510  Focal adhesion
ocu05020  Prion disease
ocu05100  Bacterial invasion of epithelial cells
ocu05205  Proteoglycans in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100342999 (CAV3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100342999 (CAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100342999 (CAV3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100342999 (CAV3)
  09164 Neurodegenerative disease
   05020 Prion disease
    100342999 (CAV3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100342999 (CAV3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100342999 (CAV3)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100342999 (CAV3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 100342999
NCBI-ProteinID: XP_002720655
UniProt: G1TZQ2
LinkDB
Position
Un
AA seq 151 aa
MMAEEHTDLEAQMVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQMCSSIKVLLRKEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgatggccgaggagcacacggacctggaggcgcagatggtcaaggacatccactgcaag
gagatcgacctggtgaaccgggaccccaagaacatcaacgaggacatcgtcaaggtggat
ttcgaagacgtgatcgcagagcccgtgggcacctacagcttcgacggggtgtggaaagtg
agctacaccaccttcaccgtgtccaagtactggtgctaccgcctgctgtccacgctgctg
ggcgtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggccgtggtgccatgcatcaagagctacctgatcgagatccagtgcatcagccacatc
tactcgctctgcatccgcaccttctgcaacccgctcttcgccgccctgggccagatgtgc
agcagcatcaaggtgctgctgcgcaaggaggtgtga

DBGET integrated database retrieval system