KEGG   Oryctolagus cuniculus (rabbit): 100008856
Entry
100008856         CDS       T03373                                 

Symbol
JUN, AP-1, C-JUN
Name
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04024  cAMP signaling pathway
ocu04137  Mitophagy - animal
ocu04210  Apoptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05224  Breast cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008856 (JUN)
   04012 ErbB signaling pathway
    100008856 (JUN)
   04310 Wnt signaling pathway
    100008856 (JUN)
   04668 TNF signaling pathway
    100008856 (JUN)
   04024 cAMP signaling pathway
    100008856 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100008856 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100008856 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100008856 (JUN)
   04530 Tight junction
    100008856 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100008856 (JUN)
   04621 NOD-like receptor signaling pathway
    100008856 (JUN)
   04625 C-type lectin receptor signaling pathway
    100008856 (JUN)
   04660 T cell receptor signaling pathway
    100008856 (JUN)
   04658 Th1 and Th2 cell differentiation
    100008856 (JUN)
   04659 Th17 cell differentiation
    100008856 (JUN)
   04657 IL-17 signaling pathway
    100008856 (JUN)
   04662 B cell receptor signaling pathway
    100008856 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100008856 (JUN)
   04915 Estrogen signaling pathway
    100008856 (JUN)
   04921 Oxytocin signaling pathway
    100008856 (JUN)
   04926 Relaxin signaling pathway
    100008856 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100008856 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100008856 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100008856 (JUN)
   05207 Chemical carcinogenesis - receptor activation
    100008856 (JUN)
   05208 Chemical carcinogenesis - reactive oxygen species
    100008856 (JUN)
   05203 Viral carcinogenesis
    100008856 (JUN)
   05231 Choline metabolism in cancer
    100008856 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008856 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100008856 (JUN)
   05211 Renal cell carcinoma
    100008856 (JUN)
   05224 Breast cancer
    100008856 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008856 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100008856 (JUN)
   05161 Hepatitis B
    100008856 (JUN)
   05171 Coronavirus disease - COVID-19
    100008856 (JUN)
   05162 Measles
    100008856 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008856 (JUN)
   05169 Epstein-Barr virus infection
    100008856 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100008856 (JUN)
   05135 Yersinia infection
    100008856 (JUN)
   05133 Pertussis
    100008856 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100008856 (JUN)
   05142 Chagas disease
    100008856 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100008856 (JUN)
   05321 Inflammatory bowel disease
    100008856 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100008856 (JUN)
   05031 Amphetamine addiction
    100008856 (JUN)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008856 (JUN)
   05418 Fluid shear stress and atherosclerosis
    100008856 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100008856 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100008856 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100008856 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100008856 (JUN)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100008856 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha TFIIA DUF3450
Other DBs
NCBI-GeneID: 100008856
NCBI-ProteinID: NP_001185876
LinkDB
Position
13
AA seq 337 aa
MSAKMETTFYDDALNASFLQTESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGGGGSGGFSAGLHSEPPVYANLSNFNPS
ALSSGGGAPSYGAAGLAFPAQPQQQQPPPPPQPPHHLPQQIPVQHPRLQALKEEPQTVPE
MPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSEL
ASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagtgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag
accgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctcatc
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctagccgag
ctgcacagccagaacacgctgcccagcgtcacgtccgcggcgcagccggtcagcggggcg
ggcatggtggctccggccgtggcctcggtggcgggcggcggcggcggcagcggcggcttc
agcgccggcctgcacagcgagccgcctgtctacgccaacctcagcaacttcaacccgagc
gcgctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcg
cagccccagcagcaacagccgccgccgccgccgcagccgccgcaccacctgccccagcag
atccccgtgcagcacccgcggctgcaggcgctcaaggaggagccgcagaccgtgcccgag
atgcccggcgagacgccgcccctgtcccccattgacatggagtcccaggagcggatcaag
gcggagaggaagcgcatgaggaaccgcatcgccgcctccaagtgccggaaaaggaagctg
gagaggatcgctcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctg
gcgtccacggccaacatgctcagggaacaggtggcacagctgaaacagaaagtcatgaac
cacgttaacagcgggtgccaactcatgctaacgcagcagttgcaaacgttctga

KEGG   Oryctolagus cuniculus (rabbit): 100338341
Entry
100338341         CDS       T03373                                 

Symbol
EIF5A, eIF-4D, eIF-5A, eIF-5A-1, eIF-5A1
Name
(RefSeq) eukaryotic translation initiation factor 5A
  KO
K04448  transcription factor AP-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04024  cAMP signaling pathway
ocu04137  Mitophagy - animal
ocu04210  Apoptosis
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05224  Breast cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100338341 (EIF5A)
   04012 ErbB signaling pathway
    100338341 (EIF5A)
   04310 Wnt signaling pathway
    100338341 (EIF5A)
   04668 TNF signaling pathway
    100338341 (EIF5A)
   04024 cAMP signaling pathway
    100338341 (EIF5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100338341 (EIF5A)
  09143 Cell growth and death
   04210 Apoptosis
    100338341 (EIF5A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100338341 (EIF5A)
   04530 Tight junction
    100338341 (EIF5A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100338341 (EIF5A)
   04621 NOD-like receptor signaling pathway
    100338341 (EIF5A)
   04625 C-type lectin receptor signaling pathway
    100338341 (EIF5A)
   04660 T cell receptor signaling pathway
    100338341 (EIF5A)
   04658 Th1 and Th2 cell differentiation
    100338341 (EIF5A)
   04659 Th17 cell differentiation
    100338341 (EIF5A)
   04657 IL-17 signaling pathway
    100338341 (EIF5A)
   04662 B cell receptor signaling pathway
    100338341 (EIF5A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100338341 (EIF5A)
   04915 Estrogen signaling pathway
    100338341 (EIF5A)
   04921 Oxytocin signaling pathway
    100338341 (EIF5A)
   04926 Relaxin signaling pathway
    100338341 (EIF5A)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100338341 (EIF5A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338341 (EIF5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338341 (EIF5A)
   05207 Chemical carcinogenesis - receptor activation
    100338341 (EIF5A)
   05208 Chemical carcinogenesis - reactive oxygen species
    100338341 (EIF5A)
   05203 Viral carcinogenesis
    100338341 (EIF5A)
   05231 Choline metabolism in cancer
    100338341 (EIF5A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100338341 (EIF5A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100338341 (EIF5A)
   05211 Renal cell carcinoma
    100338341 (EIF5A)
   05224 Breast cancer
    100338341 (EIF5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100338341 (EIF5A)
   05170 Human immunodeficiency virus 1 infection
    100338341 (EIF5A)
   05161 Hepatitis B
    100338341 (EIF5A)
   05171 Coronavirus disease - COVID-19
    100338341 (EIF5A)
   05162 Measles
    100338341 (EIF5A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100338341 (EIF5A)
   05169 Epstein-Barr virus infection
    100338341 (EIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100338341 (EIF5A)
   05135 Yersinia infection
    100338341 (EIF5A)
   05133 Pertussis
    100338341 (EIF5A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100338341 (EIF5A)
   05142 Chagas disease
    100338341 (EIF5A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100338341 (EIF5A)
   05321 Inflammatory bowel disease
    100338341 (EIF5A)
  09165 Substance dependence
   05030 Cocaine addiction
    100338341 (EIF5A)
   05031 Amphetamine addiction
    100338341 (EIF5A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100338341 (EIF5A)
   05418 Fluid shear stress and atherosclerosis
    100338341 (EIF5A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100338341 (EIF5A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100338341 (EIF5A)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100338341 (EIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100338341 (EIF5A)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100338341 (EIF5A)
SSDB
Motif
Pfam: Jun
Other DBs
NCBI-GeneID: 100338341
NCBI-ProteinID: XP_017204364
LinkDB
Position
19
AA seq 278 aa
MSAKMETTFYDDALNASFLQTESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGGGGSGSGLGGSGWARGERTGSSQCVRA
SWTRNFLKWQMIWTSRQEMQGPQPPSQCSAQHYVRMALWCSKAGHVRSSRCLLRRLASMA
MPRSTWSVLTSLLGRNMKISARQLIIWMSPTLKGMTSS
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagtgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag
accgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctcatc
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgag
ctgcacagccagaacacgctgcccagcgtcacgtccgcggcgcagccggtcagcggggcg
ggcatggtggctccggccgtggcctcggtggcgggcggcggcggcggcagcggcagcggg
ctcggaggcagcggttgggctcgcggcgagcggaccgggtcgagtcagtgcgttcgcgcg
agttggactcgaaacttcttaaaatggcagatgatttggacttcgagacaggagatgcag
gggcctcagccaccttcccaatgcagtgctcagcattacgtaagaatggctttgtggtgc
tcaaaggccggccatgtaagatcgtcgagatgtctacttcgaagactggcaagcatggcc
atgccaaggtccacctggtcggtattgacatctttactgggaagaaatatgaagatatct
gcccgtcaactcataatatggatgtccccaacattaaaaggaatgacttccagctga

KEGG   Oryctolagus cuniculus (rabbit): 100338345
Entry
100338345         CDS       T03373                                 

Symbol
FOS
Name
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04024  cAMP signaling pathway
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04713  Circadian entrainment
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04915  Estrogen signaling pathway
ocu04917  Prolactin signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04932  Non-alcoholic fatty liver disease
ocu04935  Growth hormone synthesis, secretion and action
ocu05031  Amphetamine addiction
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05224  Breast cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100338345 (FOS)
   04668 TNF signaling pathway
    100338345 (FOS)
   04024 cAMP signaling pathway
    100338345 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100338345 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100338345 (FOS)
   04660 T cell receptor signaling pathway
    100338345 (FOS)
   04658 Th1 and Th2 cell differentiation
    100338345 (FOS)
   04659 Th17 cell differentiation
    100338345 (FOS)
   04657 IL-17 signaling pathway
    100338345 (FOS)
   04662 B cell receptor signaling pathway
    100338345 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100338345 (FOS)
   04917 Prolactin signaling pathway
    100338345 (FOS)
   04921 Oxytocin signaling pathway
    100338345 (FOS)
   04926 Relaxin signaling pathway
    100338345 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100338345 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100338345 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100338345 (FOS)
   04728 Dopaminergic synapse
    100338345 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338345 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100338345 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338345 (FOS)
   05207 Chemical carcinogenesis - receptor activation
    100338345 (FOS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100338345 (FOS)
   05231 Choline metabolism in cancer
    100338345 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100338345 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100338345 (FOS)
   05224 Breast cancer
    100338345 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100338345 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100338345 (FOS)
   05161 Hepatitis B
    100338345 (FOS)
   05171 Coronavirus disease - COVID-19
    100338345 (FOS)
   05162 Measles
    100338345 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100338345 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100338345 (FOS)
   05135 Yersinia infection
    100338345 (FOS)
   05133 Pertussis
    100338345 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100338345 (FOS)
   05142 Chagas disease
    100338345 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100338345 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100338345 (FOS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100338345 (FOS)
   05418 Fluid shear stress and atherosclerosis
    100338345 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100338345 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100338345 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100338345 (FOS)
   04131 Membrane trafficking [BR:ocu04131]
    100338345 (FOS)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100338345 (FOS)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100338345 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 100338345
NCBI-ProteinID: XP_002719685
Ensembl: ENSOCUG00000021506
UniProt: G1TWI8
LinkDB
Position
20
AA seq 380 aa
MMFSGFNADYEAASSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCSDLAVSTANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYPRAGNVKTLTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVGSLDLSGGLPEAATPESEEPFS
LPLLNDPEPKPAVEPGKNLSGMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYA
ADWEPLHSGALGMGPMAAELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgccgactacgaggcagcgtcttcccgctgcagcagcgcc
tcgccagccggggacagcctctcctactaccactccccagccgactccttctccagcatg
ggctccccggtcaatgcgcaggacttctgttcggatctggccgtctccactgccaacttc
atccccaccgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcttccgtggctccgtcgcagaccagagccccccacccttacggagtccccgcc
ccctcggctggggcttacccccgggctggaaacgtgaagaccctgaccggaggcagagct
cagagcatcggccgaaggggcaaggtggagcagttgtcacccgaggaagaggagaagagg
cgaatccgaagggaaaggaataagatggctgcagccaagtgccgaaaccggaggcgggag
ctcaccgataccctgcaggcggagacagatcagctagaagacgagaagtctgcgctgcag
acggagatcgccaacctgctcaaggagaaggagaagctggagttcatcctggcagcccac
cggcccgcctgcaagatccccgatgacctgggcttccccgaggagatgtccgtgggatcc
ctggatctgagcgggggcctgcccgaggctgccaccccggagtccgaggagcctttcagt
ctgcccctcctcaacgacccggagcctaagcccgcagtggagcccggcaagaacctgagc
ggcatggagctgaaggccgagcccttcgatgacttcctgttcccagcgtcatccaggccc
agcggctcggagacggcacgctctgtgccggacgtggacctgtccggttccttctatgcc
gcagactgggagcccctgcacagtggcgccctggggatggggccgatggctgcggagctg
gagcccctgtgcaccccggtggtcacctgtaccccaagctgcaccacttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgcgccgcggcccaccgcaag
ggcagcagcagcaacgagccctcctctgactcgctcagctccccgacactgctcgccctg
tga

DBGET integrated database retrieval system