KEGG   Oryctolagus cuniculus (rabbit): 100008859
Entry
100008859         CDS       T03373                                 
Symbol
NFATC3, NFATX
Name
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04625  C-type lectin receptor signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04921  Oxytocin signaling pathway
ocu05135  Yersinia infection
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100008859 (NFATC3)
   04310 Wnt signaling pathway
    100008859 (NFATC3)
   04022 cGMP-PKG signaling pathway
    100008859 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100008859 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100008859 (NFATC3)
   04660 T cell receptor signaling pathway
    100008859 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    100008859 (NFATC3)
   04659 Th17 cell differentiation
    100008859 (NFATC3)
   04662 B cell receptor signaling pathway
    100008859 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100008859 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    100008859 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100008859 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100008859 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    100008859 (NFATC3)
   05161 Hepatitis B
    100008859 (NFATC3)
   05163 Human cytomegalovirus infection
    100008859 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008859 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100008859 (NFATC3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100008859 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100008859 (NFATC3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100008859 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100008859
NCBI-ProteinID: XP_002711678
Ensembl: ENSOCUG00000010052
UniProt: G1SYG7
LinkDB
Position
5:23619432..23774283
AA seq 1070 aa
MTTANCGSNDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHPSVLSSSLQLQGHKNYEETCDIPESKYSPLGGPKPFECPSIQITSISPNC
HQETNQHEDDVHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGCPGEDSWHQQYGLGNSLSPRQSPCHS
PRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPQHSPVPSPGHSPRGS
VTEDTWLNASVHSGSGLSPALFPFQYYVETDIPLKTRKTSEDQAAILPGKLELCSDDQGS
LSPSRETSVDDGLGSQFHLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPLDWPL
PTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPVNLQMFIGT
ADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASIPVECSQRSAQELPHIEK
YSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEV
PPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPPLPVPHPA
QSQRPSSDLGHPHDSVLSVQRNLVCPIQQGYASLVTSSHLPQLQCRDEGAGKEHMVSSSV
VHQPFQVTPTPPVGSSYQAMQTNVVYNGPTCLPVNAASSQEFDPVLFQQDAALPSLVNLG
CQPLSPIPFHSSNSGSTGHLLAHTPHSMQTPPHMPSMGYHCSNAGQRSLSSPVTDQVTGQ
PSPQLQPITYNPSHSGSAATASPAVSRPLASSPLSGPSSPQLQPMPYQSPSSGTASLPSP
ATRMHSEQHSTQAQSTGQRGLSAPSPLMCHSLCDPASFPSDGATVSIKHEPEDREPNFAT
IGLQDITLDDVNEIIGRDMSQISVSQGPGVSGEAPLSDPKSLDLGRSDGL
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggctccaacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaattcaccactt
tgcttaccacatcatggattaccgtctcacccttctgttttgtcatcatcgttgcagctc
caaggtcacaaaaactatgaagaaacttgtgatattcctgagtctaaatacagcccatta
ggtggtcccaaaccttttgagtgcccaagtattcaaattacatccatctctcctaactgt
catcaagaaaccaatcaacatgaagatgacgtacacataaatgacccagaaagggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggaatct
tcccttagtcctagtcctgccagcagcatctcttccaggagctggttctcagatgcatct
tcttgtgaatctctgtcacacatttatgatgatgtggactcagagttgaatgaagctgct
gcccgattcactcttggatcccctctgacttctccaggaggctgccctggagaagactcc
tggcatcaacagtatggacttggaaactccttgtcacccaggcaatctccttgccactct
cctagatccagtatcactgatgagaattggctgagccccaggccagcatcaggaccatca
tcgaggccaacttccccctgtgggaaacggcggcactccagtgctgaagtttgttatgct
ggatccctttcacctcaacactcacctgttccttctcctggccactccccccggggaagt
gtaacagaagatacctggcttaatgcttctgtccacagtgggtcaggccttagccccgca
ctttttccatttcagtactatgtggagactgatatccctctgaaaacaaggaaaacttct
gaagatcaagctgccatactaccaggaaaattagaactctgttcagatgatcagggaagt
ttatcaccatcacgagagacttcagtagatgatggccttggatctcagtttcatttaaag
aaagattcatctggtgaccaatttctttcagttccttcaccctttacttggagcaaacca
aagcctggccatacccctatatttcgcacatcttcattacctccactagactggccttta
ccaactcattttggacaatgtgaactgaaaatagaagtgcaacctaaaactcatcatcga
gcccattatgaaacagaaggtagccgaggggcagtaaaagcatctactgggggacatcct
gttgtgaagctcctgggctacagtgaaaagccagtaaatctacagatgtttattggaaca
gcagatgatcgatatttacgacctcatgcattctaccaagtgcatcgaatcactgggaag
acagttgctactgcaagccaagagataataattgccagcacaaaagttctggaaattcca
cttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtattttgaaactccgc
aattcagatatagaacttcgaaaaggagaaactgatattggcagaaagaatactagagtg
cgacttgtgtttcgtgtacacatcccacagcccaatggaaaagtactttctctgcagata
gcttcaatacctgtcgaatgctcccagcgatctgctcaagagcttcctcatattgagaag
tacagtattaacagttgttctgtgaatggaggtcatgaaatgattgtgactggatctaat
tttctcccagaatccaaaatcatttttcttgagaaaggacaagatggacgacctcagtgg
gaggtagaggggaaaataatcagggaaaaatgtcaaggggctcacattgtccttgaagtt
cctccatatcataacccagcagttacagctgcagtgcaggtgcacttttatctttgcaat
ggcaagaggaaaaaaagccagtctcaacgttttacatacacaccagttttgatgaagcaa
gaacacagagaagaaattgatttgtcgtcagttccacctttgcctgtgcctcatcctgcc
cagagtcagaggccttcctcagatctggggcacccacatgacagtgtgctctcagtgcag
cggaacttggtttgtccgatccagcaaggatatgcatccttggtaacttcatcccatcta
ccacagttgcagtgtagggatgagggtgctgggaaagaacacatggtatcttcttcagta
gtgcaccagccttttcaagtcacaccaacacctcctgtgggatcttcctatcaggctatg
caaactaatgttgtatacaatggaccaacttgtcttcctgttaatgctgcctctagtcaa
gaatttgatccagttttgtttcaacaggatgcagctcttcccagcttagtaaatcttggc
tgtcaaccactgtcacccataccatttcattcttcaaattctggctcaacaggacatctc
ttagcacatacacctcactctatgcagactccgcctcatatgccatcaatgggataccat
tgttcaaatgcaggacaaagatctctttcttctccagtgactgaccaggtcacaggtcag
ccttcccctcagttgcaacctattacatataatccttcacattctgggtctgctgcaaca
gcttccccagcagtctctcgtcccctggctagttcaccactttctgggccatcgtctcct
cagctgcagcctatgccttaccaatctcctagctcaggaactgcctcgttaccatctcca
gccaccagaatgcattctgaacagcactcaactcaagcacaaagtacaggccagagaggt
ctttctgcaccttcacccttaatgtgtcacagtttatgtgatccagcttcatttccatct
gatggggcaactgtgagcattaaacatgaacctgaagatcgggaacccaactttgcaacc
attggtctacaggacatcactttagatgatgtgaacgagataattgggagagacatgtcc
cagatttctgtttcccaaggaccaggggtgagcggagaggctcccctctcagatcccaag
tccctggatttaggaagatctgacgggctctag

KEGG   Oryctolagus cuniculus (rabbit): 100347003
Entry
100347003         CDS       T03373                                 
Symbol
NFATC4
Name
(RefSeq) nuclear factor of activated T-cells 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04625  C-type lectin receptor signaling pathway
ocu04921  Oxytocin signaling pathway
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100347003 (NFATC4)
   04022 cGMP-PKG signaling pathway
    100347003 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100347003 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100347003 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100347003 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    100347003 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100347003 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    100347003 (NFATC4)
   05161 Hepatitis B
    100347003 (NFATC4)
   05163 Human cytomegalovirus infection
    100347003 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100347003 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100347003 (NFATC4)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100347003 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100347003
NCBI-ProteinID: XP_002718153
Ensembl: ENSOCUG00000015145
LinkDB
Position
17:44401929..44412322
AA seq 903 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGSGEEPDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGPGGGRVLECPSIRITS
ISPTPDPPASLDDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGSAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPSSPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLARDPGSPGPFDYMGAPPAESIPQKTRRTSSEQAVALPRPEESAPCNGKLPSGAEE
APTPAGGARKEVAGMDYLAVPSPLAWSKARIGGHSPVFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPAYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLRGFPSAPGPPFGTDMDFSPPRP
PYPSYPQEDPAYETPYLSEGFGYGTPPLYPQTGPPPSYRPGLRMFPETGGTTGCARPPPV
SFLPRPFPSDPYGGRGSSFPLGVPFPPPPPAPFRPPLPSSPPLEGPFPPQSSVPALPAEG
YDEVGPGYGPGEGAPEQEKSRGGYSSGFRDSAPVQGITLEEVSEIIGRDLSGFPAPPGEE
PPA
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgggggcagcgagctgcgaggatgaggagctggaatttaagctggtgttcggggaggag
aaggaggcccccccgctgggcgcgggggggtcgggggaagaaccggactcggaagatgcc
ccaccatgctgccgtttggccctgggggagccccctccctatggcgctgcccctattggc
atcccccggcctccgccccctcggcccggcatgcactccccgccgccacgcccggccccc
tcacctggcacctgggagagccagcccgcccggtcggtgaggctcggggggccaggaggg
ggtgccgggggtcccgggggcggccgcgtcctcgagtgtcccagcatccgcatcacctcc
atctctcccacgcccgacccgcccgcctccctggacgacaaccccgacgcttggggggac
ggctctccccgcgattaccccccaccagaaggctttgggggctaccgagaagcaggcggc
cagggcgggagtgccttcttcagtccgagcccgggcagcagcagcttgtcctcgtggagc
ttcttctcggacgcctcggacgaggcggccctgtacgccgcctgcgacgaggtggagtcg
gagcttaacgaggcagcttcccgcttcggcctgggctcgccgctgccttcgccccgggcc
tcccctaggccgtggacccccgaggatccctggagcctgtacgggccaagtcctggaggc
cgggggccggaggacagctggctcctcctcagcgctcctgggcccacgccggcctcgccc
aggccttcatccccgtgcggcaagcggcgctactccagctcgggcaccccatcttcggcc
tccccggcgctgtcccgccggggcagcttgggggaagagggccctgagccacctccacca
ccacccctgcctctggcccgagaccctggctcacccggcccctttgactacatgggggcc
ccgccagctgagagcatcccgcagaagacgcggcgaacctcaagcgagcaggcggtggcc
ctgcctcggccggaggagtccgccccgtgcaatgggaagctgccctctggggcggaggag
gcccccactcccgctgggggtgcccggaaggaggtggctggcatggactacctggcggtg
ccctccccactggcttggtccaaggcccgcattgggggacacagccccgtcttcaggact
tctgccctgccccctctggattggcctctgcccagccagtatgagcagctggagctgagg
atcgaggtacagcctagagcccaccaccgggcccactacgagacagagggcagtcgtgga
gccgtcaaagcagcccctggcggtcaccccgtggtcaagctcctgggctacagtgagaag
ccactgaccctacagatgttcatcggtactgcagacgagaggaatctgcggcctcatgcc
ttctatcaggtgcaccgtatcacaggcaagatggtggccacggccagctatgaagctgtc
gtcagtggcaccaaggtgctggagatgactctgctccccgagaacaacatggcggccaac
attgactgtgccgggatcctgaagcttcggaattctgacattgagctgcggaagggcgag
acggacattgggcgcaaaaacacccgagtgcggctggtgttccgggtacacgtgccccag
ggcggtgggaaggtcgtctccgtgcaggcggcgtcggtgcccatcgagtgctcccagcgc
tcggcccaggagctgccccaggtggaggcctacagccccagcgcctgctcggtgagagga
ggcgaggaactagtgctgactggctccaacttcctgccggactccaaggtggtgttcatt
gagaggggcccagatggaaagctgcaatgggaggaggaggccacggtgaaccgactgcag
agcaatgaggtgacgctgaccctgaccgtcccagcgtacagcaacaagcgggtgtcccgg
ccagtccaggtctatttctacgtctccaatgggcggaggaagcgcagtcctacccagagt
ttcaagttcctgcctgtgatcttcaaggaggagcccttgccggactcatctctccgggga
ttcccctccgcaccgggccccccctttggcactgacatggacttctcaccacccaggccc
ccctacccctcctatccccaggaagaccccgcttatgaaactccttacctgtcggaaggc
ttcggctatggcacaccccctctctacccccaaacggggcccccaccatcctacagaccg
ggcctgcgcatgttccctgagactgggggcaccacaggctgtgcccgcccccctcctgtc
tccttccttccccggcccttccctagtgacccatatggaggccgcggctcctctttcccc
ctgggggttccattcccgcctcctcctccagccccctttcggcctccactcccttcatcc
ccaccacttgaaggccccttccccccacagagcagtgttcctgccctacctgctgagggc
tatgatgaggtagggccaggctatggccctggggagggggctccggagcaggagaaatcc
aggggtggctacagcagcggcttccgagacagtgcccctgtccagggtatcacgctggag
gaagtgagtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagaa
cctcctgcctga

KEGG   Oryctolagus cuniculus (rabbit): 100352378
Entry
100352378         CDS       T03373                                 
Symbol
NFATC1
Name
(RefSeq) nuclear factor of activated T-cells 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05135  Yersinia infection
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352378 (NFATC1)
   04310 Wnt signaling pathway
    100352378 (NFATC1)
   04024 cAMP signaling pathway
    100352378 (NFATC1)
   04022 cGMP-PKG signaling pathway
    100352378 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100352378 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100352378 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    100352378 (NFATC1)
   04660 T cell receptor signaling pathway
    100352378 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    100352378 (NFATC1)
   04659 Th17 cell differentiation
    100352378 (NFATC1)
   04662 B cell receptor signaling pathway
    100352378 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100352378 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100352378 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100352378 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352378 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    100352378 (NFATC1)
   05161 Hepatitis B
    100352378 (NFATC1)
   05163 Human cytomegalovirus infection
    100352378 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100352378 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100352378 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100352378 (NFATC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100352378 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100352378 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100352378 (NFATC1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100352378 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100352378
NCBI-ProteinID: XP_008250563
LinkDB
Position
Un
AA seq 931 aa
MPSTSFPVPSKFPLGPPAAVCGSGETLGLALPARGTMKSAEEEHYGYASSTVGSGLPLPA
AHASVPAPCHDLQTPTPGVSAVPSGTHPSGYGGAVDSGPPGYFLSSSTVRPNGAPALESP
RIEITSYLGLHHNNSQFFHDVEVEDVIPSSKRPPSTATLNLPNLEAYRDPSCLSPASSLS
SRSCNSEASSYESNYSFPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACNLGSPRHSPC
TSPRASVTEESWLGARGSRPASPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTDDS
WLGNTTQYTSSAIVAAINALTTDSSLDLAEGIPVKARKTALEHSPSLALKVEPAGEDLGS
TPPASDFPPDEFPFQHLRKGAFCDQYLSVPQHPYQWARPKSLSPTPYMSPSLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLEDEPLTLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAVLSNTKVLEIPLLPENNMRAVIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSMDSYPVSGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCQPHSLVVEI
PPFRNQRITSPVQVSFYVCNGKRKRSQFQHFTYLPASVPIIKTEPTDDYEPALTCGPTSQ
GLSPLPRPCYSQQLPAPPDPGSCLLAGFPACPPRGSLMPAPPLTSPKLHDLSSAAYTKGL
GHLGLQQPAGEVPPVQEVPGALAVHPGPPEQPAPVLQPQVSPPPSSSRSLGHQHSLCPNS
PSCQPPPATHEPHGQALPPVTGHPQHRLPKVQGREFAAAGPRPLPEVREDSSNLAPIPVT
VKREPEELDQLYLDDVNEIIRNDLSSANTHS
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgccaagtaccagcttcccagtgccttccaagtttccactcggccctccggctgcggtc
tgcggcagcggggaaactttggggctcgcgctgcccgcccgcggcaccatgaagtcggca
gaggaagaacactacggctacgcatcctccaccgtcggctccggcttgcctctgcccgcg
gcccatgcctcggtgccggccccgtgccatgacctgcagacccccaccccaggcgtctcc
gccgtcccctccgggactcacccctcggggtacggaggagccgtggacagtgggcccccg
ggctactttctgtcttccagcaccgtcaggcccaacggtgccccggccctcgagagcccg
cggattgagatcacctcgtacctgggcctgcaccacaacaacagccagtttttccacgac
gtggaggtggaagacgtcatccccagctccaaacggcccccttccacggccacgctgaac
ctgcccaacctggaggcctaccgagacccctcgtgcctgagcccggccagcagcctgtcc
tcgcggagctgcaactcggaggcctcctcctacgagtccaactactcgttcccatacgcg
tcccctcagacgtcgccatggcagtctccctgcgtgtcccccaagaccacggaccccgag
gaaggctttccccggggcctgggggcctgcaacctgggctccccccggcactcgccctgc
acctcgccccgtgccagtgtcaccgaggagagctggctgggggcgcgtggctccaggccc
gcctcgccctgcaacaagcgcaagtacagcctcaacggccgccagccctcctgctcgccc
caccactcgcccacgccgtccccgcacggctccccgcgggtcagcgtgacagacgacagc
tggctcgggaacaccacccagtacaccagttcggccatcgtggcggccatcaacgcgctg
acgacggacagcagcctggacctggccgagggcatccccgtcaaagcccgcaagaccgcc
ctggagcactccccctcgttggcgctcaaggtggagccggctggggaggacctggggagc
accccacccgcgtccgacttcccgcccgacgagttccccttccagcacctccggaagggc
gccttctgcgaccagtacctgtctgtgccgcagcacccctaccagtgggccaggcccaag
tccctgtcgcccacaccctacatgagcccgtctctgccagccctcgactggcagctgccg
tcccactcgggcccgtatgagcttcgcatcgaggtacagcccaagtcccaccacagagct
cactacgagacggagggcagccggggggccgtgaaggcgtcggccggaggacaccccatc
gtgcagctgcatggctacttagaagatgagcctctcacgctacagctgttcatcgggacg
gcagacgaccgcctgctgcggccccacgccttctaccaggtccaccggatcacgggcaag
accgtctccaccaccagccacgaggccgttctctccaacaccaaggtcctggagatcccg
ctgctgcccgagaacaacatgcgagccgtcattgactgtgccgggattttaaagctcaga
aactccgacatcgagctgcggaagggggagacagacatcggcaggaagaacacccgggtg
cggctggtgttccgcgtgcacgtcccgcagcccagtggccgcacgctgtccctccaggtc
gcctcgaaccccatcgagtgctcccagcgctcagcacaggaactgccccttgtggagaag
cagagcatggacagctacccagtcagcggcgggaagaagatggttctgtccggccacaac
ttcctgcaggactccaaggtcatctttgtggagaaagccccagatggccaccatgtctgg
gagatggaagccaaaaccgacagagacctgtgccagccgcactccttggtggtggagatc
ccgcccttccgcaaccagagaatcaccagcccggtgcaggtcagcttctacgtgtgcaac
ggcaagcggaagagaagccagttccagcacttcacctaccttcccgcctcggttcccatt
ataaagacggagcccaccgatgactacgagcctgcgctgacctgtggaccaacgagccag
ggcctgagcccgctcccgaggccctgctacagccagcagctccccgcgccgcccgacccc
ggctcctgcctgctggccggcttccccgcctgccctccgcggggctccctgatgccagcg
ccgcccctcaccagcccgaagctccacgacctgtcctccgctgcctacaccaagggcctc
ggccacctgggactgcagcagccggccggagaggtgccccccgtccaggaggtgccggga
gcgctggccgtgcaccctgggccacccgagcagccggcccccgtcctgcagccgcaggtg
agtcctcctccaagcagtagccgctcccttggtcaccagcactcactctgtcccaacagc
ccctcttgtcaacctccgcccgccacccacgagccccacggccaggccctccctccggtg
accggccacccacagcaccgcctgccgaaggttcaaggacgtgagtttgcagccgctggg
ccacggccactgccagaggtgcgtgaggacagtagtaatttggcccctattcctgtaacg
gtcaagcgtgaacctgaggagttggaccagttgtacctggacgatgtaaatgaaatcata
cggaacgacctgtccagcgccaacacccactcgtag

KEGG   Oryctolagus cuniculus (rabbit): 100353824
Entry
100353824         CDS       T03373                                 
Symbol
NFATC2
Name
(RefSeq) nuclear factor of activated T-cells 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04921  Oxytocin signaling pathway
ocu05135  Yersinia infection
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100353824 (NFATC2)
   04370 VEGF signaling pathway
    100353824 (NFATC2)
   04022 cGMP-PKG signaling pathway
    100353824 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100353824 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100353824 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    100353824 (NFATC2)
   04660 T cell receptor signaling pathway
    100353824 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    100353824 (NFATC2)
   04659 Th17 cell differentiation
    100353824 (NFATC2)
   04662 B cell receptor signaling pathway
    100353824 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100353824 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    100353824 (NFATC2)
   04380 Osteoclast differentiation
    100353824 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100353824 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100353824 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    100353824 (NFATC2)
   05161 Hepatitis B
    100353824 (NFATC2)
   05163 Human cytomegalovirus infection
    100353824 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353824 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100353824 (NFATC2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100353824 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100353824 (NFATC2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100353824 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DUF1977
Other DBs
NCBI-GeneID: 100353824
NCBI-ProteinID: XP_008248642
Ensembl: ENSOCUG00000012556
UniProt: A0A5F9DHA8
LinkDB
Position
Un
AA seq 900 aa
MQREAAFRLGLCHPLRTMGSVDQEEPSAHKAGSPPSGLEYPVDVLDCGLKPYSPLASLSG
EPPGRFAEPDRVGPQNFLSPAQPARASGPSPRIEITPSHELMQAGGSLRARDAAGLLPEQ
PLVGAAAGPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGGPD
DLCPHFQNIPTHYSPRTSPIMSPRASLAEDSCLGRHSPAPRPASRSSSPGAKRRHSCAEA
AAAPLPGASPQRSRSPSPQPRDDGAPAGYPPTAGSAVLMDALSSLAGDAPCGVPPKMWKT
SPDPSPVSTAQAKAGLPRHIYPAMEFLGPCEQEERRNSAPESILLVPPTWPKQLVPAIPI
CSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQL
HGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEP
KNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPEASGRIVSLQTASN
PIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTAESKVVFTEKTTDGQQVWEME
ATVDKDKSQPNMLFVEIPEYRNKHTRTSVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEP
TDEYDPTLICSPAHGGLGSQPYYPQHPMVAESPSCLVTTMAPCQQFRSGLPSPDARYQQQ
NPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADTHRSVLVHAGSQGQGSALLHPAPANQ
QASPVIHYSPTNQPLRCGSHQEFQHIMYCENFAPGSTRPGPPPAGQGQRLSPGSYPTVIQ
QQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgcagagagaggctgcgttcagactggggctgtgccatcccctccgcaccatggggtcc
gtggaccaagaagaaccgagtgcacataaggccggcagcccaccctccggactcgaatac
cccgttgatgtcttggactgcggcctcaagccgtacagccccctcgccagtctctctggc
gagccccctggccggttcgcagagccggatagggtagggccccagaactttctgagccca
gcccagccagcgagggcctcgggcccgagccctcggatcgagatcactccatcccacgaa
ctgatgcaggcagggggttccctccgcgcgagagacgccgccggccttctgccagagcag
ccgctggtgggggcggccgccggcccgaggttcaccttgcccgtgcctggcttcgagggc
taccgcgagccgctttgcttgagccctgcgagcagcggctcatccgccagcttcatttcc
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcggcgggccggac
gacctgtgtccccactttcaaaacatccctacccattattcccccagaacgtcgccaata
atgtcacctcgagccagcctcgccgaggacagctgcctgggccgccactcgcccgcaccc
cgtccggcctcccgctcctcatcgcctggtgccaagaggaggcattcgtgcgccgaggcc
gcggctgccccgctgcccggagcctcgccccagcgctcccggagcccctcgccgcagccc
cgggacgacggcgcccccgcgggctacccccccacggccggctctgccgtcctcatggat
gccctgagcagcctcgccggggacgcgccttgcggggttcccccgaagatgtggaagacc
agccctgacccgtcgcccgtgtccaccgcccaggccaaggccggcctgccccgccacatc
tacccggccatggagttcctggggccctgcgagcaggaggagaggaggaactcggcgccc
gagtccatcttgctggtgccgcccacctggcccaagcagctggtgcctgccatccccatc
tgcagcatcccagtgactgcgtctctccctcctctggagtggccactctccagccagtct
ggctcctatgagctacggattgaggtgcagcccaagccacaccaccgggcccactatgag
acggagggcagccgaggggccgtcaaagctccaactggaggccaccccgtggttcagctg
cacggctacatggagaacaagcctctggggctgcagatcttcatcgggacggccgacgag
cgcattctcaagccgcacgccttctaccaggtgcaccggatcacggggaaaaccgtcacc
accaccagctacgagaagatcgtgggcaacaccaaagtcctggagatcccgctggagccc
aagaacaacatgagggccaccatcgactgtgcggggatcctgaaactccgcaacgccgac
atcgagctgcgcaagggtgagacggacatcggcaggaagaacacgcgggtgaggctcgtg
ttccgggtgcacatccccgaggccagcggcaggatcgtctccttgcagacggcgtccaac
cccatcgagtgctcccagcgatccgcccacgagctgcccatggtggagagacaagacacc
gacagctgcctggtctacgggggccagcagatgatcctcactggacagaactttacggcc
gagtccaaagtcgtgtttactgagaagaccaccgatgggcagcaagtttgggagatggaa
gctacggtggataaggacaagagccagccaaacatgctttttgtcgagatccccgagtat
cggaacaagcacacccgcacgtctgtaaaggtgaacttctacgtcatcaatgggaagagg
aaacgaagccagcctcagcactttacctaccacccagtcccagccatcaagacagagccc
accgatgagtacgaccccactctgatctgcagccccgcccacggaggcctggggagccag
ccttactacccgcagcacccgatggtggccgagtccccctcctgcctggtgaccaccatg
gccccctgccagcagttccgctcggggctcccgtcccccgacgcccgctaccagcagcag
aatccggcggccgtcctctaccagcggagcaagagcttgagccccagcctgctgggctac
cagcagccggccctcatggctgcgcccctgtccctcgcggacacgcaccgctcggtgctg
gtgcatgccggctcccagggccagggctcggccctgttgcacccagcgcccgccaaccag
caggcctcaccggtgatccactactcgcccaccaaccagccgctgcgctgcgggagccac
caagagttccagcacatcatgtactgcgagaacttcgcgcccggctccaccaggcccggc
ccgccccccgccggtcaaggtcagaggctgagcccaggctcctaccccacggtcattcag
cagcagaatgccacgagtcaaagagctgccaaaaacggacccccggtcagtgaccaaaag
gaagtcctacctgcgggagtgacgatcaagcaggagcagaacctggaccagacctacctg
gatgacgttaacgagattatcaggaaggagttttcaggacctcccgccagaaaccagacg
taa

DBGET integrated database retrieval system