Oryctolagus cuniculus (rabbit): 100008875 Help Entry 100008875         CDS       T03373                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01524   Platinum drug resistance ocu04014   Ras signaling pathway ocu04064   NF-kappa B signaling pathway ocu04115   p53 signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04621   NOD-like receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05022   Pathways of neurodegeneration - multiple diseases ocu05145   Toxoplasmosis ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05168   Herpes simplex virus 1 infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05202   Transcriptional misregulation in cancer ocu05212   Pancreatic cancer ocu05220   Chronic myeloid leukemia ocu05222   Small cell lung cancer ocu05225   Hepatocellular carcinoma ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100008875 (BCL2L1)    04630 JAK-STAT signaling pathway     100008875 (BCL2L1)    04064 NF-kappa B signaling pathway     100008875 (BCL2L1)    04151 PI3K-Akt signaling pathway     100008875 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100008875 (BCL2L1)    04137 Mitophagy - animal     100008875 (BCL2L1)   09143 Cell growth and death    04215 Apoptosis - multiple species     100008875 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100008875 (BCL2L1)    05202 Transcriptional misregulation in cancer     100008875 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100008875 (BCL2L1)    05225 Hepatocellular carcinoma     100008875 (BCL2L1)    05220 Chronic myeloid leukemia     100008875 (BCL2L1)    05222 Small cell lung cancer     100008875 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100008875 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100008875 (BCL2L1)    05162 Measles     100008875 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100008875 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100008875 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100008875 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100008875 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100008875 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100008875 (BCL2L1)    01524 Platinum drug resistance     100008875 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocu01009]     100008875 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100008875 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ocu02000]     100008875 (BCL2L1) Protein phosphatases and associated proteins [BR:ocu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100008875 (BCL2L1) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100008875 (BCL2L1) Transporters [BR:ocu02000]  Other transporters   Pores ion channels [TC:1]    100008875 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100008875 NCBI-ProteinID:  NP_001075604 Ensembl:  ENSOCUG00000003201 UniProt:  Q9MYW4 LinkDB All DBs Position 4:15157462..15215700 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTGPEMETPSAINGNPAWHPA DSPAVNGATGHSSSLDAREVIPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcgcagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccggaaggg actggaccagagatggagacccccagtgccatcaatggcaacccagcctggcacccggcg gacagccccgcggtgaacggagccactggccacagcagcagtttggatgcccgggaggtg atccccatgacagcagtgaagcaggctctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaagtagtgaacgaactcttccgggatggggtgaactggggccgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtggacaaggagatggag gtattggtgagtcggatcgcggcgtggatggccacttacctgaatgaccacctggagccc tggatccaggagaacggcggctgggacacgtttgtggaactctacggcaacaacgcagca gccgagagccgcaagggccaggagcgcttcaaccgctggttcctgacgggcatgaccgtg gctggcgtggttctgctgggctccctcttcagtcggaaatga

Oryctolagus cuniculus (rabbit): 103349397 Help Entry 103349397         CDS       T03373                                  Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04064   NF-kappa B signaling pathway ocu04066   HIF-1 signaling pathway ocu04071   Sphingolipid signaling pathway ocu04115   p53 signaling pathway ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04261   Adrenergic signaling in cardiomyocytes ocu04340   Hedgehog signaling pathway ocu04510   Focal adhesion ocu04621   NOD-like receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu04722   Neurotrophin signaling pathway ocu04725   Cholinergic synapse ocu04915   Estrogen signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05014   Amyotrophic lateral sclerosis ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05210   Colorectal cancer ocu05215   Prostate cancer ocu05222   Small cell lung cancer ocu05226   Gastric cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103349397  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103349397    04064 NF-kappa B signaling pathway     103349397    04066 HIF-1 signaling pathway     103349397    04071 Sphingolipid signaling pathway     103349397    04151 PI3K-Akt signaling pathway     103349397  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103349397   09143 Cell growth and death    04215 Apoptosis - multiple species     103349397  09150 Organismal Systems   09152 Endocrine system    04915 Estrogen signaling pathway     103349397    04928 Parathyroid hormone synthesis, secretion and action     103349397   09156 Nervous system    04725 Cholinergic synapse     103349397    04722 Neurotrophin signaling pathway     103349397  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103349397    05206 MicroRNAs in cancer     103349397    05207 Chemical carcinogenesis - receptor activation     103349397   09162 Cancer: specific types    05210 Colorectal cancer     103349397    05226 Gastric cancer     103349397    05215 Prostate cancer     103349397    05222 Small cell lung cancer     103349397   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103349397    05161 Hepatitis B     103349397    05162 Measles     103349397    05169 Epstein-Barr virus infection     103349397   09171 Infectious disease: bacterial    05152 Tuberculosis     103349397   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103349397   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103349397    05022 Pathways of neurodegeneration - multiple diseases     103349397   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103349397    05418 Fluid shear stress and atherosclerosis     103349397   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103349397   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103349397    01524 Platinum drug resistance     103349397    01522 Endocrine resistance     103349397  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocu01009]     103349397 Protein phosphatases and associated proteins [BR:ocu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103349397 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  103349397 NCBI-ProteinID:  XP_008259661 Ensembl:  ENSOCUG00000025312 UniProt:  G1TW27 LinkDB All DBs Position 9:12635739..12805678 Genome browser AA seq 226 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAART SPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNG GWDAFVELYGPSVRPLSDFSWVSLKTLFSLALIGACITLGAYLGHK NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgccgggcgaacagggtacgacaaccgggagatcgtgatgaagtacatccac tataagctgtcccagaggggctacgagtgggacgctggggacgcgggcgccgcctccgcg ccgggcgtcttctcctcccagcccgcgcccgctgcgccccgggacccggccgccaggacc tcgccgccgccgccgccggccgccgcggggcccgcgctcagcccggtgccacctgtggtc cacctgaccctccgccaggcgggcgacgacttctcccggcgctaccgccgcgacttcgcg gagatgtccagccagctgcacctgacgcccttcaccgcgagggggcgctttgccacggtg gtggaggagctcttcagggatggggtgaactgggggaggattgtggccttctttgagttc ggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacaacatc gccctgtggatgactgagtacctgaaccggcacctgcacacctggatccaggataatgga ggctgggatgccttcgtggaactgtacggccccagcgtgcggcctctgtcagacttctcc tgggtgtctctgaagactttgttcagcctggccctgataggagcttgcatcaccctcggt gcctacctgggccacaagtga

DBGET integrated database retrieval system