KEGG   Oryctolagus cuniculus (rabbit): 100008921
Entry
100008921         CDS       T03373                                 
Name
(RefSeq) platelet microbicidal protein 1
  KO
K05407  platelet factor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008921
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008921
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100008921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008921
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100008921
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100008921
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100008921
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100008921
NCBI-ProteinID: NP_001075631
UniProt: Q5VI85
LinkDB
Position
15:complement(76280877..76281825)
AA seq 106 aa
MSIPEASGAPRPRPSRGLLLLGLLLLLTVAAAASDDPKESEGDLHCVCVKTTSLVRPRHI
TNLELIKAGGHCPTAQLIATLKNGRKLCLDPQAALYKKVIKKLLKE
NT seq 321 nt   +upstreamnt  +downstreamnt
atgagcatcccagaggcgtctggtgccccccgaccccggccaagccgcggactgttgctc
ctgggactgctgctgctgctgactgtggcagccgccgccagtgatgacccaaaagaaagt
gagggagacctgcactgcgtgtgtgtgaagaccacttccctcgtccggcccaggcacatc
accaacctggagctgatcaaggccggaggccactgccccaccgcccaactgatagccacg
ctgaagaacgggaggaaactctgcctggatccgcaggcggccctgtacaagaaagtgatc
aagaaactcctgaaggagtag

KEGG   Oryctolagus cuniculus (rabbit): 100144333
Entry
100144333         CDS       T03373                                 
Symbol
CXCL13
Name
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144333 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144333 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100144333 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100144333 (CXCL13)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100144333 (CXCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100144333
NCBI-ProteinID: XP_008265919
Ensembl: ENSOCUG00000024738
UniProt: G1TR38
LinkDB
Position
15:complement(72854649..72860866)
AA seq 105 aa
MRLTSASLLFTLLVSSLSPAQGVLEAYNTDLKCECVQETANYIPIRFIDRLQIVPPGNGC
PKREVIVWLKTKIAVCVKPHAKWLQKLIQILQKKTMLSTPPAPVI
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaggctcacctcggcatctctgctgttcaccctgctggtcagcagcctctctccagcc
caaggtgtcctggaggcctacaacacagacttgaagtgtgagtgtgttcaagagactgcg
aactacatccccatacgcttcatcgatcggctccaaattgtgccccctggcaatggctgc
ccaaagagagaagtcatagtgtggctgaagacgaagatagctgtatgtgtgaaacctcat
gccaaatggctccaaaaactcatacagatactgcagaaaaaaactatgctttcaactcca
ccagctccagtgatttag

KEGG   Oryctolagus cuniculus (rabbit): 100340593
Entry
100340593         CDS       T03373                                 
Symbol
CXCL11
Name
(RefSeq) C-X-C motif chemokine ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340593 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100340593 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100340593 (CXCL11)
   04062 Chemokine signaling pathway
    100340593 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100340593 (CXCL11)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100340593 (CXCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100340593
NCBI-ProteinID: XP_002717052
Ensembl: ENSOCUG00000026515
LinkDB
Position
15:74344568..74346546
AA seq 99 aa
MSVKGVLLVLAVILCATTVQGFPMFKGGRCLCTGPGVKAVKVADVQKATIIYPSGSCDKT
EVIITLKAKKGQQCLNPRSKQASLIIKQIERKTLRNQNV
NT seq 300 nt   +upstreamnt  +downstreamnt
atgagtgtgaagggtgtgcttttagtcttggctgtgatactctgtgctacaactgttcaa
ggcttccccatgttcaaagggggacgctgtctttgcacaggccctggagtaaaagcagtc
aaagtggcagatgttcagaaagccaccataatttacccaagcggcagctgtgacaaaaca
gaagtaattatcaccctgaaagcaaaaaaaggacaacaatgcctgaatcccagatccaag
caagcaagtcttataatcaagcaaattgaaagaaagactttaagaaatcaaaatgtatga

KEGG   Oryctolagus cuniculus (rabbit): 100353112
Entry
100353112         CDS       T03373                                 
Symbol
CXCL10
Name
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu05160  Hepatitis C
ocu05164  Influenza A
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100353112 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100353112 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100353112 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100353112 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    100353112 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    100353112 (CXCL10)
   04657 IL-17 signaling pathway
    100353112 (CXCL10)
   04062 Chemokine signaling pathway
    100353112 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100353112 (CXCL10)
   05171 Coronavirus disease - COVID-19
    100353112 (CXCL10)
   05164 Influenza A
    100353112 (CXCL10)
   05169 Epstein-Barr virus infection
    100353112 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100353112 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100353112 (CXCL10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100353112 (CXCL10)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100353112 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100353112
NCBI-ProteinID: XP_002717152
Ensembl: ENSOCUG00000016280
UniProt: G1TBA6
LinkDB
Position
15:74368975..74371297
AA seq 98 aa
MNQSAILIFCLIFLTLSGTKGMPLSRTVRCTCINISNKPVNPRSLEKLEIIPASQSCANV
EIIATMKKDGEKRCLNPELKAIKKLLKAFSKERSRGSS
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaccaaagtgcaattcttattttctgccttattttcctgactctgagtgggactaaa
ggaatgcctctctctagaactgtacgctgtacctgtatcaacattagtaataaacctgtt
aatccaagatccttggaaaaacttgaaatcattcctgcaagtcaatcttgtgcaaatgtt
gagatcattgccacaatgaaaaaggatggggagaagagatgtctgaatccagaattgaaa
gccatcaagaagttgctgaaagcatttagcaaggaaaggtccagaggatcatcgtaa

KEGG   Oryctolagus cuniculus (rabbit): 103350772
Entry
103350772         CDS       T03373                                 
Symbol
CXCL9
Name
(RefSeq) C-X-C motif chemokine ligand 9
  KO
K05416  C-X-C motif chemokine 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103350772 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103350772 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103350772 (CXCL9)
   04062 Chemokine signaling pathway
    103350772 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103350772 (CXCL9)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103350772 (CXCL9)
SSDB
Motif
Pfam: IL8 DUF6675 Rtf2
Other DBs
NCBI-GeneID: 103350772
NCBI-ProteinID: XP_008265949
Ensembl: ENSOCUG00000029588
UniProt: U3KNX2
LinkDB
Position
15:74394560..74401450
AA seq 153 aa
MVPKSMFCKEFLRLPIQYKSDLTGLHSTTMKKSCVLFLLGFTFLVLIGVQGSPIMRNGRC
SCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKK
QSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
NT seq 462 nt   +upstreamnt  +downstreamnt
atggttcccaagagcatgttttgtaaagaatttctcaggcttccaatccagtacaagagt
gacttaacaggactccattccaccactatgaagaaaagttgtgttctgttcctcttgggt
ttcaccttcttggttctgattggagttcaaggaagtccaataatgaggaatggacgctgt
tcttgcatcagcagcacccaagggaagatccacctacaatccttaaaagaccttaaacag
ttttccccaagcccttcctgtgggaagactgaaatcattgccacaaagaaggatgggact
caaatatgtctaaatccggattcaaccgaggtgaaagaattggtagaaaagtggaaaaaa
cagagtagcccaaagaaaaagcaaaagaaagggaaaaaacagcgcaaagtcaagaaatct
ctcaaaaagtctcaacgtcctcatcaaaagaagactgcataa

DBGET integrated database retrieval system