KEGG   Oryctolagus cuniculus (rabbit): 100008930
Entry
100008930         CDS       T03373                                 
Symbol
YWHAQ
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100008930 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    100008930 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100008930 (YWHAQ)
   04114 Oocyte meiosis
    100008930 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100008930 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100008930 (YWHAQ)
   05160 Hepatitis C
    100008930 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100008930 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008930 (YWHAQ)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100008930 (YWHAQ)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100008930 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 100008930
NCBI-ProteinID: NP_001075637
Ensembl: ENSOCUG00000010482
UniProt: Q6Q6X0
LinkDB
Position
Un
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctatcggtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgatacctcggacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtcgcttgtggtgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
caacctacacatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatccagagcttgcctgcacactggctaaaacggcttttgatgaagccatc
gccgagcttgatacactgaatgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagca
gaaggggcggaaaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100328734
Entry
100328734         CDS       T03373                                 
Symbol
YWHAH
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100328734 (YWHAH)
   04151 PI3K-Akt signaling pathway
    100328734 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100328734 (YWHAH)
   04114 Oocyte meiosis
    100328734 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100328734 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100328734 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100328734 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100328734 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100328734 (YWHAH)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100328734 (YWHAH)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100328734 (YWHAH)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100328734 (YWHAH)
SSDB
Motif
Pfam: 14-3-3 CodY
Other DBs
NCBI-GeneID: 100328734
NCBI-ProteinID: NP_001164827
Ensembl: ENSOCUG00000007090
UniProt: B7NZM8
LinkDB
Position
21:4316205..4325994
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
DAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaccgtgagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgatatggcctccgccatgaaggcggtgaccgagctgaatgaacccctctccaatgaa
gatcgaaacctcctgtccgtggcctacaagaacgtggttggtgccaggcgatcctcttgg
cgggtcatcagcagcattgagcagaaaaccatggcggatggaaatgaaaagaagctggag
aaagtgaaagcctaccgggagaagatcgagaaggagctggagaccgtctgcaatgatgtc
ctggctctgctcgacaagttcctcatcaagaactgcaatgatttccagtatgagagcaag
gtgttttacctgaaaatgaagggcgattactaccgctacctggccgaggtggcttccggg
gagaagaagaacagcgtggtcgaagcatctgaggccgcctacaaggaagcctttgagatc
agcaaagagcacatgcagccgacgcaccccatccggctgggcctggccctcaacttctcg
gtgttctactacgagatccagaatgctccggagcaggcctgcctcttagccaaacaagcc
tttgatgacgccatagctgagctggacacgctaaacgaggattcctataaggactccacg
ctcatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gacgccggagaaggcaactga

KEGG   Oryctolagus cuniculus (rabbit): 100342694
Entry
100342694         CDS       T03373                                 
Symbol
YWHAZ
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100342694 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    100342694 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342694 (YWHAZ)
   04114 Oocyte meiosis
    100342694 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100342694 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100342694 (YWHAZ)
   05160 Hepatitis C
    100342694 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100342694 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100342694 (YWHAZ)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100342694 (YWHAZ)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100342694 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 FliM CSN7a_helixI Peptidase_C98
Other DBs
NCBI-GeneID: 100342694
NCBI-ProteinID: XP_002710764
Ensembl: ENSOCUG00000000734
LinkDB
Position
3:complement(116510211..116537512)
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaaactggctgagcaggccgagcggtatgat
gacatggcagcttgcatgaagtctgtgaccgagcaaggagctgagttatctaacgaggag
aggaatcttctctcggtagcctataaaaatgtcgtaggagcccgcaggtcatcttggagg
gtcgtctcaagtattgagcaaaagaccgaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccctaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacctggctgaggttgctgctggtgatgacaagaagggg
attgtggatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacgcatcctatcagattgggtctggcccttaacttctctgtgttctattacgag
attctgaattccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacgttaagtgaagaatcatacaaagacagcacgctaataatgcagtta
ctgagagacaacttgacattgtggacatcggacacccaaggagatgaagctgaagcagga
gaaggaggggagaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100354276
Entry
100354276         CDS       T03373                                 
Symbol
YWHAG
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100354276 (YWHAG)
   04151 PI3K-Akt signaling pathway
    100354276 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100354276 (YWHAG)
   04114 Oocyte meiosis
    100354276 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100354276 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100354276 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100354276 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100354276 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100354276 (YWHAG)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100354276 (YWHAG)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100354276 (YWHAG)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100354276 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 DUF3504 SF3A2
Other DBs
NCBI-GeneID: 100354276
NCBI-ProteinID: XP_002711950
Ensembl: ENSOCUG00000008521
UniProt: G1TZP0
LinkDB
Position
6:26713490..26740700
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLGLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRASVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccgactggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacggagctgaacgagccgctgtccaatgaa
gagcggaacctcctgtcggtggcgtacaagaacgtggtgggggcgcgccgctcctcctgg
cgggtcatcagcagcatcgagcagaagacgtccgccgacggcaacgagaagaagatcgag
atggtgcgcgcctaccgggagaagatcgagaaggagctggaggctgtgtgccaggacgtg
ctgggcctgctggacaactacctgatcaagaactgcagcgagacccagtacgagagcaaa
gtgttctacctgaagatgaaaggggactactaccgctacctggccgaggtggccaccggc
gagaagcgggccagcgtggtggagtcctccgagaaggcctacagcgaagcccacgagatc
agcaaggagcacatgcagcccactcaccccatccggctaggcctggccctcaactactcc
gtgttctactacgagatccagaacgcgccggagcaggcctgccacctggccaagacggcc
ttcgacgacgccatcgccgagcttgacacgctgaacgaggactcctacaaggactccacc
ctcatcatgcagctgctccgtgacaacctcacgctctggacaagcgaccagcaggacgac
gacggcggggaaggcaacaactag

KEGG   Oryctolagus cuniculus (rabbit): 100358299
Entry
100358299         CDS       T03373                                 
Symbol
YWHAB
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100358299 (YWHAB)
   04151 PI3K-Akt signaling pathway
    100358299 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100358299 (YWHAB)
   04114 Oocyte meiosis
    100358299 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100358299 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100358299 (YWHAB)
   05160 Hepatitis C
    100358299 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100358299 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358299 (YWHAB)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100358299 (YWHAB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100358299 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 100358299
NCBI-ProteinID: XP_002721273
Ensembl: ENSOCUG00000003002
UniProt: G1SIT9
LinkDB
Position
Un
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggacaaaagtgagctggtacagaaagccaaactggctgagcaggccgagcgc
tatgatgatatggctgcagccatgaaggccgtcacggaacaagggcacgagctctccaat
gaagagagaaacctgctctctgtggcctataagaacgtggtaggcgcccgccgttcttcc
tggcgtgtcatctccagcattgaacagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagagctgcaggacatctgcaatgatgttctg
gagctgttggacaaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaggtggcatctggagacaataag
caaaccactgtatcgaactcccagcaggcttaccaggaagcatttgaaatcagtaagaaa
gaaatgcagcccacacacccaattcggcttggcctggcgctcaacttctccgtcttttac
tacgagattctaaactcccctgaaaaggcttgcagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacactgaatgaagaatcttacaaagacagcaccctgatcatg
cagttgcttagagacaatctcaccctgtggacgtcggaaaaccagggagatgaaggagat
gctggggagggagagaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100358813
Entry
100358813         CDS       T03373                                 
Symbol
YWHAE
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu05160  Hepatitis C
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100358813 (YWHAE)
   04151 PI3K-Akt signaling pathway
    100358813 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100358813 (YWHAE)
   04114 Oocyte meiosis
    100358813 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100358813 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100358813 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100358813 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100358813 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100358813 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358813 (YWHAE)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100358813 (YWHAE)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100358813 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 100358813
NCBI-ProteinID: XP_002718936
Ensembl: ENSOCUG00000014607
LinkDB
Position
19:16722397..16768599
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEEKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggatgtggagctgacagttgaa
gaaagaaacctcttatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagagaagctaaaa
atgattcgggagtatcggcaaatggttgagactgagctaaagttaatttgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggccgagtttgccacaggaaatgac
aggaaggaggctgcagagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccacccacgcatcccattcgtttaggactcgctctcaatttttctgtattc
tactatgaaatccttaattcccctgaccgtgcctgcaggttggcgaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggggatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

DBGET integrated database retrieval system