KEGG   Oryctolagus cuniculus (rabbit): 100008930
Entry
100008930         CDS       T03373                                 
Symbol
YWHAQ
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100008930 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    100008930 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100008930 (YWHAQ)
   04114 Oocyte meiosis
    100008930 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100008930 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100008930 (YWHAQ)
   05160 Hepatitis C
    100008930 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100008930 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008930 (YWHAQ)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100008930 (YWHAQ)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100008930 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 100008930
NCBI-ProteinID: NP_001075637
Ensembl: ENSOCUG00000010482
UniProt: Q6Q6X0
LinkDB
Position
Un
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctatcggtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgatacctcggacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtcgcttgtggtgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
caacctacacatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatccagagcttgcctgcacactggctaaaacggcttttgatgaagccatc
gccgagcttgatacactgaatgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagca
gaaggggcggaaaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100342694
Entry
100342694         CDS       T03373                                 
Symbol
YWHAZ
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100342694 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    100342694 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342694 (YWHAZ)
   04114 Oocyte meiosis
    100342694 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100342694 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100342694 (YWHAZ)
   05160 Hepatitis C
    100342694 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100342694 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100342694 (YWHAZ)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100342694 (YWHAZ)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100342694 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 FliM CSN7a_helixI Peptidase_C98
Other DBs
NCBI-GeneID: 100342694
NCBI-ProteinID: XP_002710764
Ensembl: ENSOCUG00000000734
LinkDB
Position
3:complement(116510211..116537512)
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaaactggctgagcaggccgagcggtatgat
gacatggcagcttgcatgaagtctgtgaccgagcaaggagctgagttatctaacgaggag
aggaatcttctctcggtagcctataaaaatgtcgtaggagcccgcaggtcatcttggagg
gtcgtctcaagtattgagcaaaagaccgaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccctaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacctggctgaggttgctgctggtgatgacaagaagggg
attgtggatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacgcatcctatcagattgggtctggcccttaacttctctgtgttctattacgag
attctgaattccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacgttaagtgaagaatcatacaaagacagcacgctaataatgcagtta
ctgagagacaacttgacattgtggacatcggacacccaaggagatgaagctgaagcagga
gaaggaggggagaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100358299
Entry
100358299         CDS       T03373                                 
Symbol
YWHAB
Name
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04390  Hippo signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100358299 (YWHAB)
   04151 PI3K-Akt signaling pathway
    100358299 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100358299 (YWHAB)
   04114 Oocyte meiosis
    100358299 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100358299 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100358299 (YWHAB)
   05160 Hepatitis C
    100358299 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100358299 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358299 (YWHAB)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100358299 (YWHAB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100358299 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 100358299
NCBI-ProteinID: XP_002721273
Ensembl: ENSOCUG00000003002
UniProt: G1SIT9
LinkDB
Position
Un
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggacaaaagtgagctggtacagaaagccaaactggctgagcaggccgagcgc
tatgatgatatggctgcagccatgaaggccgtcacggaacaagggcacgagctctccaat
gaagagagaaacctgctctctgtggcctataagaacgtggtaggcgcccgccgttcttcc
tggcgtgtcatctccagcattgaacagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagagctgcaggacatctgcaatgatgttctg
gagctgttggacaaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaggtggcatctggagacaataag
caaaccactgtatcgaactcccagcaggcttaccaggaagcatttgaaatcagtaagaaa
gaaatgcagcccacacacccaattcggcttggcctggcgctcaacttctccgtcttttac
tacgagattctaaactcccctgaaaaggcttgcagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacactgaatgaagaatcttacaaagacagcaccctgatcatg
cagttgcttagagacaatctcaccctgtggacgtcggaaaaccagggagatgaaggagat
gctggggagggagagaactaa

DBGET integrated database retrieval system