KEGG   Oryctolagus cuniculus (rabbit): 100008949
Entry
100008949         CDS       T03373                                 
Symbol
ACAP2, CENTB2, cenB1A
Name
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100008949 (ACAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100008949 (ACAP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008949 (ACAP2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100008949 (ACAP2)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100008949 (ACAP2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100008949 (ACAP2)
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_2 Ank_5 Ank Ank_4 Ank_3 PH_8 PH_11
Other DBs
NCBI-GeneID: 100008949
NCBI-ProteinID: NP_001075643
Ensembl: ENSOCUG00000001798
UniProt: Q6IVG4
LinkDB
Position
14:complement(90982053..91140157)
AA seq 778 aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCLANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALAKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCVPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIKAKYVERKFVDKYSVSSSPPEQEKKVVSKDSEEKRLS
IPKLGPGDQVRTSIQSSVKSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSVFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgaagatgacggtggatttcgaggagtgtctgaaggactcaccccgcttcagggctgct
ttggaagaagtagaaggagatgtggctgaattggaactaaaacttgataagcttgtgaag
ctctgtattgccatgattgataccggaaaagccttttgtcttgcaaataaacagttcatg
aacgggatccgagacctggcccagtattctagtaatgatgctgtagttgaaacaagtttg
accaagttttctgacagtcttcaagaaatgataaattttcacacaatcctgtttgaccaa
actcagagatcaattaaggcacagcttcagaactttgttaaagaagatcttagaaaattt
aaagatgccaagaagcaatttgaaaaagtcagtgaagagaaagaaaacgcattggcaaaa
aatgcccaagtacaaagaaacaaacagcatgaagttgaagaagccacaaacattttgaca
gccacaagaaaatgttttcgacatatagcccttgactatgtactccagattaatgttctt
caatcaaaaaggagatctgaaatcctaaaatcaatgttatcctttatgtatgcccatttg
gcgttctttcatcaaggatatgatttatttagtgaactcggaccctacatgaaagatctt
ggagcacagttggatcgactagttgtggatgcagcaaaggagaaaagagagatggaacaa
aaacattccaccattcaacaaaaggatttctccagtgatgattctaagttagaatacaac
gtcgatgctgcaaatggcattgttatggaaggctatctgttcaagcgagccagcaatgcc
ttcaaaacttggaacagacgctggttttcaatacagaacaatcagctggtttaccagaaa
aagtttaaggataatcccactgtagtagttgaagatctcaggctatgcactgtgaaacat
tgtgaagatatagaaaggcgattctgctttgaggtggtctctccaactaaaagttgtatg
ctccaggcagattctgaaaagctacgccaggcatggattaaagctgttcagaccagtatt
gctactgcttatagagagaagggtgatgaatcagagaagctggataagaaatcatctcca
tccacaggaagcctagattctggaaatgagtcaaaagagaaattattaaaaggagaaagt
gcactgcagcgggtccagtgtgtccctgggaatgctagctgttgtgactgtggtctggca
gatccacggtgggccagcatcaacttaggcatcaccttgtgcattgagtgctctgggatt
cacaggagtcttggggttcatttttcaaaagtgcgatctttaactttagacacctgggag
cctgaacttttaaagcttatgtgtgagttggggaatgatgttataaacagagtttatgaa
gctaacgtggaaaaaatgggaataaagaagccacaaccaggacaaagacaggagaaagag
gcatatatcaaagcaaaatatgtggaaaggaaatttgtggataaatattctgtatcatca
tcacctcctgagcaggaaaaaaaggttgtctccaaagatagcgaagaaaagaggctgagc
attcctaaacttgggccaggcgaccaagtcagaacatccatccagagttcagttaaaagt
aatgacagtggaatccagcagagttctgatgatggaagagaatctttaccctccacagtg
tcagccaatagtttatatgagcctgaaggagaaaggcaagattcttctgtgtttctcgat
tctaaacatcttaatccaggacttcagctctacagggcttcatatgaaaaaaatcttcca
aaaatggctgaggctttggctcatggtgcagatgtgaactgggctaattcagaggaaaac
aaagcaacaccacttattcaggctgtattagggggctctttggtgacatgcgagttcctt
ctacagaatggtgctaatgtgaaccaaagagatgttcaagggcggggaccactgcaccat
gccaccgtcttagggcatacagggcaggtgtgtttatttctaaaacgaggtgccaatcaa
catgccactgatgaagaagggaaagaccctttgagcatagctgtagaagcagccaatgct
gatatagtaaccttgttacgcttagcaagaatgaatgaagagatgcgggaatccgaagga
ctttatggacagccaggtgatgaaacgtaccaggatatttttcgtgatttttcccaaatg
gcatccaataatccagagaaattaaatcgtttccagcaggactcacagaaattctga

KEGG   Oryctolagus cuniculus (rabbit): 100338826
Entry
100338826         CDS       T03373                                 
Symbol
SMAP2
Name
(RefSeq) small ArfGAP2
  KO
K12486  stromal membrane-associated protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338826 (SMAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338826 (SMAP2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100338826 (SMAP2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100338826 (SMAP2)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 100338826
NCBI-ProteinID: XP_002715232
Ensembl: ENSOCUG00000015858
UniProt: G1TAD2
LinkDB
Position
13:complement(126102478..126156308)
AA seq 429 aa
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEK
KKYMDRSLDINAFRKEKDDKWKRGSESVPEKKMEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSVPRKVVGSMPTAGSAGS
VPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSF
PGVTPPNSILGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMVGVPNGMMATQQA
GYMAGMAAMPQTVYGVPPAQQLQWNLTQVTQQMAGMNFYGANGVMNYGQSMSGGNGQAAN
QTLSPQMWK
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgacgggcaagtcggtgaaggacgtggatcggtaccaggcggtcctggccaacctgctg
ctggaggaggataacaagttctgtgcggactgccagtccaaagggccacgatgggcctcc
tggaacattggtgtcttcatctgcattcgctgtgctggaatccacaggaacctgggggtg
cacatatccagggtaaaatcagtaaacctcgaccagtggactcaagaacagattcagtgc
atgcaagagatggggaatggaaaggcaaaccgcctttatgaagcctaccttcctgagacg
tttcggcgaccacagatagacccagctgtcgagggatttatccgagataaatacgagaag
aagaaatacatggaccggagtctggatatcaatgcctttaggaaagaaaaagatgataag
tggaaaagagggagtgaatcagttccagagaaaaaaatggaacctgttgtttttgagaaa
gtgaaaatgccacagaaaaaggaagatccccagctacctcggaaaagctccccgaaatcc
acggcacccgtcatggatttgttgggcctcgatgctccggtggcttgctccattgcgaat
agtaagaccagcaataccctagagaaggatttagatctcttggcctctgttccatcccct
tcttcctcggttcccagaaaggttgtcggttccatgccaactgcaggcagtgccggttct
gttcctgaaaacctgaacctgtttccagagccagggagcaaatctgaagaaataggcaag
aagcagctctcaaaagactccatcctttctctgtatggatcccagacgcctcagatgcct
gcccaagcaatgttcatggctccagctcagatggcgtatcctacagcctaccccagcttc
cctggagtcacacctcctaacagcatcctggggagcatgatgcccccgccagtaggcatg
gtagctcagccaggagcttctggaatggttgcccccatggccatgcctgcaggctacatg
ggtggcatgcaggcatcaatggtgggcgtgccgaacgggatgatggccacccagcaggct
ggctacatggcaggcatggcagctatgccccagactgtgtatggggttccgcctgctcag
cagctgcagtggaacctcacccaggtgacccagcagatggctgggatgaacttctacgga
gccaacggcgtgatgaactatggacagtcaatgagcggtggaaacggacaggcagcgaat
cagactctcagccctcagatgtggaaatag

KEGG   Oryctolagus cuniculus (rabbit): 100339132
Entry
100339132         CDS       T03373                                 
Symbol
ARFGAP1
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 1
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100339132 (ARFGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339132 (ARFGAP1)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100339132 (ARFGAP1)
SSDB
Motif
Pfam: ArfGap zf-piccolo
Other DBs
NCBI-GeneID: 100339132
NCBI-ProteinID: XP_008251644
Ensembl: ENSOCUG00000006024
LinkDB
Position
Un
AA seq 411 aa
MASPRTRKVLKEVRVRDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDLELEKMKVGGNAKFREFLESQADYDPCWSLQDKYESRAAALFRDKVATLAE
GRAWSLESSPAQNWTPPQPRTSLATAHRASGQTQNASASADKAFEDWLNDDLGSYQGAQE
NRYVGFGNTVPPQKREDDFLNSAMSSLCSGWSSFTTGASKFASAAKEGATKFGSQASQKF
WGHRQQPEPASELGHSLNENILRPAQEKVKEGRIFDDVSSGVSQLASKVQGVSSKGWRDV
TTFFSGRAEESSQNSGGDSAQGSALDQSFWETFGSPEPPKAKSPSSDSWTCADASAEKRS
SDSWDVWGSSARNSNSDGWESGEGASGEGRAKAAKKAVPAPAEEDWDNQNW
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggccagcccgaggacccggaaagttctgaaggaggtcagggtgcgggacgagaacaat
gtctgttttgagtgtggcgctttcaacccgcagtgggtcagtgtgacctacggcatctgg
atctgcctagagtgctcggggagacaccgcgggctgggcgtgcacctcagcttcgtgcgc
tcggtcacgatggacaagtggaaggacctggagctggagaagatgaaggtggggggcaac
gccaagttccgggagttcctggagtcccaggccgactacgacccctgctggtccctgcag
gacaagtacgagagcagggccgcggccctcttcagggacaaggtggccaccctggctgaa
ggcagagcgtggtctctggagtcgtcacctgcccagaactggaccccaccccagcccagg
acgtcgttggccactgcccaccgggcctccgggcagactcagaacgcgtccgcgtccgca
gacaaggccttcgaggactggctgaacgacgacctcggctcctatcagggggcccaggag
aatcgctacgtggggtttgggaacacggtgccgccccagaagagagaggacgacttcctc
aacagcgccatgtcctcgctctgctcgggttggagcagttttaccaccggagcgagcaag
ttcgcctcagcagctaaggagggcgctacaaagttcggatcccaggccagtcagaagttt
tggggtcacaggcagcagccagagccggcctctgagttgggccacagcctgaacgagaac
attctccgaccagcccaggagaaggtgaaggagggaaggatttttgatgatgtgtccagt
ggggtctctcagttggcgtccaaggtccagggagtcagcagcaaaggctggagggacgtc
accaccttcttttctgggagagcagaggagagctcccagaacagcggtggggacagcgcg
cagggcagcgccctggaccagagcttctgggagaccttcggcagccccgagccccccaag
gccaagtccccgagcagcgacagctggacctgcgccgacgcctcggccgagaagcggagc
tcggacagctgggacgtgtggggctcgtccgccaggaacagcaacagcgacggctgggag
agcggcgagggcgccagcggcgagggcagggccaaggctgccaagaaggcggtgccggcc
cccgccgaggaggactgggacaaccagaactggtag

KEGG   Oryctolagus cuniculus (rabbit): 100341403
Entry
100341403         CDS       T03373                                 
Symbol
ARAP1
Name
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  KO
K18439  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341403 (ARAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341403 (ARAP1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100341403 (ARAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100341403 (ARAP1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100341403 (ARAP1)
SSDB
Motif
Pfam: PH RhoGAP ArfGap RA PH_11 PH_6 PH_8 PH_13
Other DBs
NCBI-GeneID: 100341403
NCBI-ProteinID: XP_008262589
Ensembl: ENSOCUG00000021605
LinkDB
Position
1:143705569..143739444
AA seq 1398 aa
MGMLLPGHRRRILAGLLRAHAPPAPSPCPTPRPVPMKRHIFRSPPAPAAPPEPLPAAGEG
AGQPAVPPIPPRRSCQPPACFSAPDPLPPPLPAKRHLVEPSVPPVPPRTGPPRLLVSLPS
KEEGSLPATQVSPPQPEPVEPPFTLPCGAPQPLSPPPCPPEIPPKPSRPPPEFDESDYDE
VPEEGPRAPASVMTKKEEPPVSRVPRAVRVASLLSEGEELSGEEEEEEDHAYEGVPNGGW
RTDSLSSSPPGLVPELVPPAVAMDGLPGGSTSVTRVIKAGWLDKNPPQGSYIYQKRWVRL
DADYLRYFDSNKDAYSKRFVAVACISRVAATGDQKFEVITHNRTFSFRAESDVERKEWMQ
ALQQAVAEQRARARLSGAYPLGARGLEQPDHAGSLELRGFKNKLYVAVVGDKVQLYKNLE
EYHLGIGITFIDMSVGNVKEADRRSFDLTTPYHIFSFSADSEPEKEQWLEAMQGAIAEAL
STSEVAERIWAAAPNRSCADCGAAQPDWASINLCVVMCKRCAGEHRGLGAGVSKVRSLKM
DRKVWTETLIQLFLHLGNGAGNRFWAANVPPSEALQPSSSPGARRRHLEAKYREGKYRRY
HPLFGNQEELDKALCVAVTTTDLAETQALLGCGAAVSCFLGDPEAPTPLALAEQAGQTLQ
MEFLRNNQGTGVPRPDSTLPLEKHYSVVLPTVSHSGFLYKTASVAKPLQDRRAREEFSRR
WCVLSDGVLSYYETERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGL
ESAELAHEWVTCIAKAFVPPLAEDLLAQDFERLGRLPYKAGLSLQRAQEGWFCLAASELH
AVFPEGPCEEPLQLRKLQELSVQGDNENQVLVLVERRRTLYIQGERRLDFVGWLAAIQKA
AASLGDTLSEQQLGDSDIPVIVYRCVDYITQYGLTSEGIYRKCGQTSKTQRLLESLRQDA
RSVRLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASETEEEEEKVSRYRELLL
RLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAGRVVEDLI
NHYVLVFNVDKEELRKQREEVTAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHVK
IPASMTAEELTLEILDRRNVGVREKDYWTCFEVNEREEAERPLHYSEKVLPILHGLGMDS
HLVVKKHQSMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLR
LYKEVRSQRPWSGAPETSHRPEKEWPVKSLKVYLGVKKKLRPPTCWGFTVVHETERHEKQ
QWYLCCDTQMELREWFAAFLFVQHDGLVWPSERSRASRAVPEVRLGSVALIPLRGSENEM
RRSVAAFTADPLSLLRNV
NT seq 4197 nt   +upstreamnt  +downstreamnt
atgggcatgctcctccctggccaccgccgccgcatcctggcgggcctgctccgtgcccac
gcgcccccggcccccagcccctgccccaccccacggcctgtgcccatgaagcgccacatc
ttccgctcgccacctgcacctgctgctccacccgagccgctgcctgcggctggagagggt
gcggggcagcctgcggtgcctcccatcccgccccgcaggagctgccagccgcctgcctgc
ttctccgccccggaccccctgccgcccccgctgcctgccaagcggcatcttgtggagccc
agcgttccacccgtgcccccacgcacgggcccgccccgcctgctggtgagcctgccctcc
aaggaagaggggtccttgccggcaacccaggtgtcccctccccagcctgagcctgtggag
cccccattcaccctcccctgtggggctccccagcctctgtctccgcctccctgccccccg
gagatcccaccgaagccttcccgcccgcccccggagtttgatgagtccgactacgatgag
gtcccagaggaggggcccagggccccagccagcgtgatgaccaagaaggaggagcctccg
gtgagccgagtcccgcgggccgtgcgtgtggccagtctgctgagtgagggagaggagctg
tctggagaggaggaggaggaggaggaccacgcctatgagggcgtccccaatggtggatgg
cgcaccgacagcctgagctcctccccgcctggcctcgtccccgagcttgtaccgcctgcc
gtggccatggacgggctgcccgggggctccacctccgtcacacgggtcatcaaggctggc
tggctggacaagaacccacctcaggggtcgtacatctatcagaagcgatgggtgagactg
gacgctgattacctgcgctacttcgacagtaacaaggatgcctactccaagcgctttgtc
gctgtcgcctgcatctcccgcgtggctgccactggtgaccagaagttcgaagtgatcacc
cacaaccggaccttttccttccgggcagagagtgatgtggagcggaaggagtggatgcag
gccctgcagcaggccgtggcggagcagcgggcccgggcccggctgtccggcgcttacccg
ttaggagcccgaggcttagagcagcccgaccacgctggcagcctggagctgcgtggcttc
aagaataagctgtatgtggccgtggtcggggacaaagtgcagctctacaagaatctggag
gagtaccacctgggcatcggcatcaccttcatcgacatgagtgtgggtaacgtgaaggaa
gccgaccggcgcagcttcgacctcaccacgccctaccacatcttcagcttctccgccgac
tcggagccagagaaggagcagtggctggaggccatgcagggagccatagccgaggccctg
tcgacctcggaggtggccgagcgcatctgggccgcggcccccaacaggtcctgtgccgac
tgtggggctgcgcagcccgactgggcctccatcaacctctgcgtggtcatgtgcaagcgc
tgtgcaggggagcaccgtggcctgggcgctggtgtatccaaggtgcgaagcctgaagatg
gacaggaaggtgtggacagaaacgctcatccagctcttcttacacctgggcaatggcgct
gggaaccgcttctgggcagccaatgtgccccccagtgaggccctgcagcccagcagcagc
cctggtgcccggcggcgccacctggaggccaagtaccgtgagggcaagtaccgccgctac
cacccactctttgggaaccaggaggaactggacaaggccctgtgcgtcgcagtcaccacc
acagacctggctgagacgcaggcgctgctgggctgcggggccgccgtgagctgctttctc
ggagaccctgaggcccccacgcccctggctcttgccgagcaggcggggcagacactgcag
atggaattcctccggaacaaccagggcacgggcgtgcctcggccggactcgacgctgccc
ctggagaagcactactctgtcgtgctgccaaccgtgagccacagtggcttcctctacaag
accgcctcagttgccaagccactgcaggaccgccgtgcccgagaagagttcagccggcgc
tggtgtgtccttagcgacggggtcttgagctactatgagactgagcgggcagtgaccccc
aacggggagattcgggccagcgagattgtgtgcctggcagtgccccctcccgacacccat
ggctttgagcacacctttgaggtgtacacggagggagaacggctctacctgtttgggctg
gagagtgcggagctggcccatgaatgggtcacgtgcattgctaaggcattcgtgcctccc
ctggcggaggatctgctggcccaggactttgagcggcttgggcgcctaccctacaaagct
ggcctgagcctgcagcgggcccaggagggctggttctgcctcgccgcctccgagctccac
gccgtcttcccagagggaccctgcgaggagccgctgcagctgcggaaactgcaggagctc
tccgtccaaggggacaatgagaaccaggtgctggtgctagtggagcgaaggaggacactg
tacatccagggggagcggcggctggacttcgtgggctggctggccgccatccagaaagca
gcagccagcttgggggacaccctgtcggaacagcagctgggcgactcggacatcccagtg
atcgtgtaccgctgtgtggactacatcacgcagtatggcctgacctccgagggcatctac
cgcaagtgcgggcagacgtcgaagacgcagcggcttctggagagcctgcggcaggacgcg
cgctccgtgcgcctcaaggagggcgagcagcatgtggacgacgtctcctccgccctcaag
cgcttcctgcgcgacctgcccgatgggctcttcactcgtgcccagcgcctggcctggctg
gaagcctcagagacagaggaagaggaggagaaggtctccaggtaccgagagctcctgctg
cgtctgcctcctgtcaaccgggccaccgtgaaggcgctcatcagccacctgtactgcgtc
cagtgcttctcagacaccaaccagatgaacacgcacaacctggccatcgtgtttgggccc
acgctgttccagacggatgggcaggactacaaggctggccgtgtggtggaagacctcatt
aaccactatgtgctggtgtttaacgtggacaaggaggagctgaggaagcagcgggaggag
gtcacggccatcgtgaagatgcgagtggccggcactgctagtgggacccagcatgctggc
gacttcatctgcaccgtgtacctggaggagaagaaggcagagacggagcagcatgtcaag
atccccgcctccatgacagccgaggagctcaccctggagatcctggatcgccggaacgtg
ggcgtcagggagaaggactactggacctgcttcgaggtcaacgagagggaggaggcagag
cgtcccctgcactactcggagaaggtgctacccatcctgcacgggctgggcatggacagc
cacctggtggtgaagaagcaccagtccatggaggccatgctgctctacctggccagccgt
gtgggcgacaccaagcacggcatgatgaagttccgggaggaccgcagcctcctgggcctg
ggcctgccctcgggcggcttccacgaccgctacttcatcctcaacagcagctgcctgcgg
ctctacaaggaggtccggagccagaggccatggagcggggcccctgagaccagtcaccgg
cctgagaaggagtggcccgtgaagagccttaaagtctacctgggggtgaagaagaaactc
cggcctcccacctgctggggcttcacggtggtgcacgagacagagagacacgagaagcag
cagtggtacctgtgctgcgacacacagatggagctccgggagtggttcgccgccttcctc
tttgtgcagcacgacggcctggtgtggccctccgagcggtcgcgcgcgtcgcgggcggtg
cccgaggtccggctgggcagcgtggcgctcatccccctgcgcggcagtgagaacgagatg
cgccgcagcgtggcggccttcaccgcggacccgctctccctcctccgcaacgtctga

KEGG   Oryctolagus cuniculus (rabbit): 100344961
Entry
100344961         CDS       T03373                                 
Symbol
AGAP1
Name
(RefSeq) arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344961 (AGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344961 (AGAP1)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100344961 (AGAP1)
SSDB
Motif
Pfam: ArfGap Ras PH Ank_2 Ank_5 Ank Ank_4 Ank_3 PH_6 Roc
Other DBs
NCBI-GeneID: 100344961
NCBI-ProteinID: XP_008250072
Ensembl: ENSOCUG00000012670
LinkDB
Position
Un
AA seq 1070 aa
MYLLDSSGEPASPPADAMPRGTPPRKTVYRISVTMVRKEQLAASGPDPRPARRPRPPRSP
DAPGRLVEEAEEAAGAEDSEDREPRAWDLRTFRTRSTGQLELGRLRPCARGPDPVDLAGG
GPPAAEEGPSSPDLEGARAAPLRRSLSFRHWSGPEESPPLGVGRRHGSSGSLTWDAGDGA
AAQPASEKRNTLDVGEVLNKGDARSDAERWECSKSKNRTLDNSDLQRLERARAAAAGPGA
ASERRLLRFFSGIFARRDGAARQRGYFSSLRRAPADVHSSSAESIGGSPRRDAFVNSQEW
TLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEDLDAGGRFKKEIVVDGQSYL
LLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRSTGEVPLVLVGTQ
DAISSSNPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLS
IGPCKSLPNSPSHSSVCSAQVSAVHTSQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPP
TANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLEGRADSIGSGRAIPIKQGMLLKRSGK
SLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAP
ISSPKTNGLSKDMSSLHISPNSDTGLGDSVCSSPSISSTASPKLDPPPSPHANRKKHRRK
KSTGNFKADGLSGTAEAKRRAWKLNRVGSLRNIYSSSANTEEQEENFEFIIVSLTGQTWH
FEATTYEERDAWVQAIESQILASLQSCESSRNKSRLTSQSEAMALQSIRNIRGNSHCVDC
DTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSAIGNELANS
VWEESCQGRAKPSLDSTREEKERWIRAKYEQKLFLAPLPCSELSLGQHLLRATADEDLRT
VILLLAHGSRDEVNETCGEGDGRTALHLACRKGSVVLAQLLIWYGVDVMARDAHGNTALA
YARQAPSQECVDVLLQYGCPDERFVLMATPNLSRKSNHRSNSGGRAPAVI
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtacctgctggacagcagcggcgagcccgcgtcgccgcccgcggacgcgatgcctcgc
gggacgccccccaggaagacggtctaccgcatctccgtgaccatggtcaggaaggagcag
ctggccgcgtccggccccgacccgcgccctgctcggcggccccggcccccgcgctccccg
gacgcgcctgggcggctcgtggaggaggccgaggaggcggcgggcgctgaggactccgag
gaccgcgagccgcgcgcctgggacttgcgcactttccggacccgcagcaccgggcagctg
gagctggggcggctccggccgtgcgctcgcggcccggacccggtggacctggccggcggc
ggccctccggctgcggaggagggtcccagcagccccgacctggagggggcccgggccgcg
cccctgcggcggagcctcagtttcaggcactggagcggcccggaggagagcccgcccctg
ggcgtcgggaggcgccacggcagctccgggagcctgacctgggatgcgggcgacggggcc
gccgcgcagccggcgtcggagaagcgcaacaccctggacgtgggcgaggtgctcaacaag
ggcgacgcgcgctcggacgcggagcgctgggagtgcagcaagagcaagaaccgcacgctg
gacaacagcgacctgcagcggctggagcgcgcgcgggccgccgccgccggccccggcgcg
gcctcggagcgccggctgctgcgcttcttcagcggcatcttcgcgcgcagggacggcgcc
gcgcgccagcggggttatttcagcagcctgcggcgggcccccgccgacgtgcactcgtcc
agcgccgagagcatcggcgggtccccgcgcagagatgccttcgtgaacagccaggagtgg
acgctaagccgatcggtgccggagctgaaagtgggaattgtgggtaacttggccagcggc
aagtccgccctggtgcaccggtacctgacgggcacgtatgtgcaggaggagtcccccgaa
gacttggacgcaggtggcaggttcaagaaagagattgtggtggacggccagagctatctg
ctgctgattcgtgatgaagggggccccccggaggcgcagtttgccatgtgggtggacgcg
gtcatattcgtcttcagcttggaggacgagatcagtttccagacggtttaccactactac
agccggatggccaactatcgcagcacgggcgaggtccctctggtgctggtgggcacccag
gacgccatcagctccagcaacccgcgggtgatcgacgacgcgcgtgcgcggaagctgtcc
aacgacctgaagcgctgcacgtactacgagacgtgcgccacgtacgggctcaacgtggag
agggtctttcaggacgtcgcccagaagattgtagccacgaggaagaagcagcagctgtcc
ataggcccctgcaagtctctccccaactcccccagccactcctctgtgtgctccgcccag
gtgtcggccgtgcacacaagccagacaagtaacggcggtgggagtttaagcgactactcc
tcctcagttccgtcgacgccaagcaccagccagaaggagcttcggatcgacgtccccccc
acggccaacacgcccacgcccgtccggaagcagtccaagcgccgctccaacctgttcacc
tctcggaaagggagcgacccagacaaagagaagaaggggctggagggccgtgcggacagc
atcgggagcgggcgagccatcccaattaaacagggcatgctcctgaagcggagcggcaag
tctctgaacaaggagtggaagaagaagtacgtgaccctgtgtgacaacggcgtgctgacc
taccacccgagcctgcatgattacatgcagaacgtccatggcaaggagatcgaccttctg
agaaccactgtgaaagtccccggcaagaggccgccccgcgccacgtcggcctgcgcgccc
atctccagccccaaaaccaacggcctgtccaaggacatgagcagtttacacatctcaccc
aattcagacacggggctgggagactccgtgtgctccagcccaagtatctccagcaccgcc
agccccaagctcgacccgcccccctccccccacgccaacagaaagaagcaccggaggaag
aaaagcaccggcaacttcaaggccgacggcctgtccggcactgcggaagccaaacgcaga
gcatggaaactaaaccgtgttggtagcctgcgaaatatatacagcagcagcgccaacacc
gaagagcaagaggagaacttcgagttcatcatcgtgtcgctcacggggcagacgtggcac
tttgaggccaccacgtacgaagagcgggacgcgtgggtccaagccatcgagagccagatc
ctagccagcctccagtcctgcgagagcagcaggaataagtcccgactcaccagccagagt
gaagccatggccctgcagtcgatccggaacatccgcgggaactcccactgtgtggactgc
gacacccagaatcccaactgggccagcttgaacttgggagccctcatgtgcatcgagtgc
tcggggatccaccggaatctcggcacccacctttctcgagtccgctccctggacctggac
gactggccggtggagctgatcaaggtgatgtcggccatcggcaacgagctggccaacagc
gtctgggaggagagctgccaggggcgggcaaaaccctcgctggactccaccagggaggaa
aaggaacggtggatccgggccaagtatgagcagaagctgttcctggccccgctgccctgc
tccgagctgtccctgggccagcatctgctgcgggccaccgccgacgaggacctgcggacg
gtcatcctgctgctggcgcacggctcccgggacgaggtgaacgagacctgcggggaggga
gacggccgcacggcgctgcacctggcctgccgcaaggggagcgtggtcctggcgcagctc
ctgatctggtacggcgtggacgtgatggcccgagacgcgcacgggaacacggcgctggcc
tacgcccggcaggcccccagccaggagtgcgtggacgtcctgctgcagtacggctgcccg
gacgagcgcttcgtgctcatggccacgcccaacctgtccaggaagagcaaccaccgcagc
aacagtggcgggagggcgcccgccgtcatctga

KEGG   Oryctolagus cuniculus (rabbit): 100346808
Entry
100346808         CDS       T03373                                 
Symbol
ASAP3
Name
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100346808 (ASAP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100346808 (ASAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100346808 (ASAP3)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100346808 (ASAP3)
SSDB
Motif
Pfam: ArfGap BAR_3 PH Ank_2 Ank_3 Ank_5 Ank_4 Ank PH_3 PH_2 PH_13
Other DBs
NCBI-GeneID: 100346808
NCBI-ProteinID: XP_017201962
Ensembl: ENSOCUG00000000227
LinkDB
Position
13:129768826..129793052
AA seq 785 aa
MKGHLRDGRQDSRKHLEKAWKDYEAKVTRLEKERDRTRMTGGSPGEVAQDTQRERRIFQL
HMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLSPFIEKLAASVHTLH
QAQEEELQKLTQLRDSLRGSLQLDSREEHLSRKNSGGGYSIHQHQGNKQFGTEKVGFLYK
KSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEDKKCFDLVTHSRT
YHFHAEDEQECEAWVSVLQNSKDEALSSAFLGEPSSGPGPWAGAGLDAEPQELTKLLIAE
VKSRPGNGHCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSEL
LLALNIGNMRFNEVMEAQLPSHRSPKPTAESDMSTRRDYIVAKYVEHKFARRCTPEPQRL
RTAICNRDLLSVLEAFANRQDFGQPLPGPDGQAPGELALHLAVQVASPASLPLVEFIIQN
GGHLDAKAADGNTALHYAALANQPDCLKLLLKGRAVAGTVNEAGETALDIARRKQHKECE
ELLEQAQAGTLTFPLHVDYSWGISTEPGSDSEEDEEEKRCSLKPSAQAHCAGGRLDITNK
MYETLGSLGAAPPQSQSEACPPPLPVKHSARSTLQGRAGPGVADHSEVPSLSVEHPESPE
SPGSPASSCSSSLTSPVDPGGPSQAPLSSENLREALGASRFSLIPGTTPTETHLPVRFRH
HGDFGLSLPSSSESTRSYRRGGRSLEDSPSARQPVPRRNAPAGCTEGDGSRPGVLPASSV
QLLQD
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgaaggggcatctgagagacgggcggcaggattccagaaaacacctggagaaggcgtgg
aaggactacgaagccaaggtgaccaggctggagaaggagcgggaccggaccaggatgact
ggagggagcccgggggaggtggcccaagacacgcagagagagcgacgcatctttcagctg
cacatgtgtgagtacctgctcaaagctggggagagccagatgaagcaaggtcctgacttc
ctccagagcctcatcaagttcttccacgcccagcacaacttcttccaagacggctggaag
gccgcccagagcctgtcccccttcatcgagaagctggcggcctcagtgcacacgctgcat
caagcccaggaggaggagctacagaagctgacccagctccgggactccctccgagggtcg
cttcagcttgacagcagagaggagcacctgagccggaagaactcaggcggcggctacagc
atccaccagcatcaaggcaacaagcagtttgggacggagaaggtgggctttctgtacaag
aaaagtgatggaatccggagagtctggcagaagaggaagtgtggggtcaagtacggctgc
ctgaccatctcgcacagcacgataaaccggcccccagtgaagctgaccctgctgacgtgc
caagtgagaccaaacccggaggacaaaaagtgtttcgacctggtgacccacagccggacg
taccacttccacgccgaggacgagcaggagtgtgaggcgtgggtgtcagtgctgcagaac
agcaaggacgaagccctgagcagcgccttcctcggggagcccagcagcggccccgggccc
tgggcgggcgccgggctggacgcggagccccaggagctcacgaagctgctcatcgccgag
gtgaagagccggcccggcaatggccactgctgcgactgcggggccgcagaccccacgtgg
ctcagcaccaacctgggcgtgctcacctgcatccagtgctccggcgtccaccgcgagctg
ggcgtgcgcttctcccgcatgcagtccctcaccttggacctgctgggcccatccgagttg
ctgctggccttgaacatcggaaacatgcgcttcaatgaggtcatggaggcccagctgccc
tcacaccgcagccctaagcccacagccgagagtgacatgagcacccgcagggactacatc
gtggccaagtatgtggaacacaagtttgcccgccgctgcaccccagagcctcagagactc
cggacggccatttgcaacagggacctcctgtcggtcctggaggcctttgccaaccggcag
gatttcggacagccgctgccagggccggatgggcaggcacccggagagctcgccctgcac
ttggccgtccaagtggccagcccagcctcgctgcccctggtggagttcatcatccagaac
ggcggtcacctggatgccaaggctgccgacgggaacaccgctctgcactatgcggccctt
gctaaccagccagattgcctcaagctgctgctgaaagggagagccgtggctggcacagtg
aacgaggcaggagagacagcactggacatagccagaaggaagcagcacaaggagtgtgaa
gagctgctggagcaggcccaggcggggaccctcaccttccccctgcacgtggactactcc
tgggggatttccacagagcccggctctgacagtgaggaggatgaggaggagaagcgctgc
tctctgaagccctcggcccaggcccactgtgccggtgggaggttggacatcaccaacaag
atgtacgagaccctcggcagcctgggagcagcgccgcctcagagccagagtgaggcctgc
cccccgcccttgcccgtcaagcactctgcgcggagcacgctccagggccgagcaggaccc
ggtgttgcagatcattccgaagtccccagcctgagtgtggagcaccccgaaagccctgag
agcccaggcagtccagcgtcctcctgctcctccagccttacgagcccggtggacccgggg
ggtcccagccaggccccgctcagctcagagaacctccgggaggcgctgggagcgtcccga
ttcagcctgatacctgggaccacccctacggagacgcacctgcccgtcaggttcaggcac
cacggcgactttggcctttctctgccgtccagctctgaaagcactcgctcctatcgacgc
gggggccggagcctggaagacagtccctccgccaggcagcctgtgcccagaaggaatgca
ccggccggctgcactgaaggagatggctccaggccaggagttctcccggcaagttctgta
caacttctgcaagactag

KEGG   Oryctolagus cuniculus (rabbit): 100347771
Entry
100347771         CDS       T03373                                 
Symbol
GIT1
Name
(RefSeq) GIT ArfGAP 1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347771 (GIT1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100347771 (GIT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347771 (GIT1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100347771 (GIT1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100347771 (GIT1)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_4 Ank_5 Shugoshin_N Ank ZapB YabA T7SS_ESX_EspC SAM_KSR1
Other DBs
NCBI-GeneID: 100347771
NCBI-ProteinID: XP_008269194
Ensembl: ENSOCUG00000016586
LinkDB
Position
19:18615172..18622818
AA seq 771 aa
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADRSRQKCMSQSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRE
NDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEA
KRRQQGKSLSSPTDHLELSARSQSDLDDQHDYDSVASDEDTDQEPLRSAGATRNNRARSM
DSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQL
RQPPGPAPTPPLPSERAEHTPMGPGGSTHRRDRQAFSMYEPGSALKPFGGGAPADELSTR
LQPFHSSELEDDTMYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSSSQEGSRHASKLSRH
GSGADSDYENTQSGDPLLGLEGKRFLELGKEEDLHPELESLDGDLDPGLPSTEDVILKTE
QVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAY
RLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgtcccggaaggggccgcgagcggaggtgtgtgcggactgcagcgccccggaccctggc
tgggcatccatcagcaggggtgtgctggtgtgtgacgagtgctgcagtgtgcaccggagc
ctgggacgccacatctccattgtcaagcaccttcgccacagcgcctggcctcccacactg
ctgcagatggtgcacacgctcgccagcaacggggccaactccatctgggagcactccctg
ctggaccccgcacaagtgcagagcggccggcgcaaagccaacccgcaagacaaagtccac
cccatcaagtccgagttcatcagggccaagtaccagatgctggcgtttgtgcacaagctt
ccctgccgggacgatgatggggtcaccgccaaagacctcagcaagcaactgcactcaagc
gtgcggaccggcaacctggagacatgtctgcgcctgctgtccttgggcgcccaggccaac
ttcttccacccagagaagggcaccacacccctgcacgtggctgccaaggcagggcagacg
ctgcaggcagagctgctggtcgtgtacggggctgaccctggctcccccgacgttaatggc
cgcacacccatcgactatgccaggcaggccgggcaccatgaactggcggaaaggctagtc
gagtgccagtatgagctcactgaccggctggccttctacctctgtggacgtaagccggat
cacaagaatgggcattacatcatcccacagatggctgacaggtctcggcaaaagtgcatg
tctcagagcctggacctgtctgagttggcaaaagctgcaaagaagaagctgcaggcgctc
agcaaccggctttttgaagagcttgccatggacgtgtatgacgaggtagaccggagagag
aatgacgcggtgtggctggccacccagaaccacagcacactggtgacggagcgcagcgcc
gtgcccttcctgccggttaacccggagtactcggctacccggaatcaggggcgacagaag
ttggcccgcttcaacgcccgcgagtttgccaccttgatcatcgacattctcagcgaggcc
aagcggaggcagcagggaaagagcctgagcagcccgacagaccacctcgagctgtctgca
cggagccagagcgacctggacgaccagcacgactacgacagcgtagcctctgacgaggac
acggaccaggagcccctgcgcagtgccggcgccacccggaacaaccgcgcccggagcatg
gactcctcggacctgtcggacggggcggtgacgctgcaggagtacctggagctgaagaag
gccctggccacctcggaggccaaagtgcagcaactcatgaaggtcaacagcagcctgagc
gacgagctccggcggctacagagggagatccacaagctgcaggcagagaacctgcagctg
cggcagcccccggggccggcgcccacacccccgctccccagtgagcgggcggaacacacc
cccatggggcccggcgggagcacccaccgcagggaccgccaggccttctccatgtacgag
ccgggctctgccctgaagcccttcggcggcggcgcgcctgcggacgagctcagcacgcgg
ctgcagccgttccacagctccgagctcgaggacgacaccatgtactcggtgcatgtccct
gctggcctgtaccggatccggaagggggtgtctgcctcagccgtgcccttcacgccctcc
tccccgcttctgtccagctcccaggaaggaagccgccacgcgagcaagctctcgcgccac
ggcagcggtgctgacagcgactatgagaacacacagagcggggacccactgctggggctg
gaagggaagcggtttctggagctaggcaaagaggaggacttgcacccggagttggagagc
ctggacggggacctggaccccgggctgcccagcacggaggacgtcattctgaagacagag
caggtcaccaagaacatccaggagctgctgcgggcggcccaggagttcaagcatgacagc
tttgtgccctgctcagagaagatccatctggctgtgaccgagatggcctctctcttccca
aagaggccagccctggagccggtgcgcagctccctccggctgctcaacgccagcgcctac
cggctgcagagtgagtgccggaagacggtgccgccggagcctggcgcccccgtggacttc
cagctgctgactcagcaggtgatccagtgcgcctacgacattgccaaggctgccaagcag
ctggtcaccatcaccacccgagagaagaagcagtga

KEGG   Oryctolagus cuniculus (rabbit): 100348106
Entry
100348106         CDS       T03373                                 
Symbol
GIT2
Name
(RefSeq) GIT ArfGAP 2
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348106 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100348106 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100348106 (GIT2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100348106 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100348106 (GIT2)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_5 Ank_4 Ank TTRAP zf-RRN7 CRIC_ras_sig DMPK_coil BORCS8 Shugoshin_N
Other DBs
NCBI-GeneID: 100348106
NCBI-ProteinID: XP_002722028
Ensembl: ENSOCUG00000001057
LinkDB
Position
Un
AA seq 729 aa
MSKRLRSSEVCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASILSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTTKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSNGKTPVDYARQGGHHELADRLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
PLSSAKDNVELILKTISNQHSTESQDNDQPDYDSVASDEDTDVDTAASRANRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNTCQVQTGSEYPDTSNHSSLKRRPSARGSRPMSMYETGSGQNPYLPMGEASHPEESRTR
LQPFPAHASRLEKQNSTPESDYDNTPNDMEPDDLGSGRKGRQRSMVWPGDSSVADTAEPH
AAPSPSLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYVPCSERIHVAVTEMAALFPKK
PRSDTVKTSLRLLTSSAYRLQSECKKALPGDSGSPTDVQQVTQQVIQCAYDIAKAAKQLV
TLTTKENNN
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtcgaagcggctccggagcagcgaggtgtgcgctgactgcagcgggccggatccttcc
tgggcatccgtaaacaggggcacgtttatctgtgacgagtgctgcagtgtccatcggagc
ctggggcgccacatctcccaagtgaggcacctgaagcacacgccgtggcctccgacgctg
ctgcagatggttgaaaccttgtataacaatggtgctaattctatatgggagcattccttg
ctggaccctgcctctattctgagcggaagacgcaaagctaatccacaggataaagtacat
cccaataaagcagaattcatcagagccaagtatcagatgttagcctttgtgcatcgcctg
ccctgccgggatgacgacagcgtgaccaccaaagacctgagcaagcaactccattcaagt
gtgagaacagggaatcttgaaacctgcctgaggctgttatctttaggagcacaggccaac
ttctttcaccctgaaaaaggaaacaccccactccatgtggcttccaaagcagggcagatt
ttgcaggctgaattattggcagtatatggagcagaccctggcacgcaagattctaatggg
aaaacacctgttgattatgccaggcaaggagggcaccatgagctggcagatcgccttgtg
gaaatacagtacgagctgactgacagactagccttctatctctgtggcaggaaaccagat
cacaaaaatggacagcactttattatacctcaaatggcagacagcagcctggatttgtct
gaactggcaaaagctgctaagaagaaacttcagtccctaagtaatcatttgtttgaagaa
cttgccatggatgtgtacgatgaagttgacaggcgagagactgatgcagtctggcttgcc
acacaaaaccacagcaccttggtaaccgagacaaccgtcgtcccctttcttccggtcaat
cccgagtactcgtcaacacgaaaccagggcagacagaaattagctcggtttaatgcacac
gagtttgccacgctggtcatcgacattctcagcgacgccaagaggaggcagcaaggcagt
cctctctctagtgccaaagacaatgtggagctcatactgaaaaccatcagtaaccagcac
agcaccgagagtcaggacaatgaccagccagactatgacagtgtggcttcagacgaagac
acggatgtggacacagcagcaagcagagcaaaccggcagaagagcctagattcagattta
tcagatggaccagtcactgtacaggaatttatggaggtcaaaaacgctctagtggcttct
gaggccaagatacaacagctaatgaaggtgaataacaacttgagtgacgagctgagaatt
atgcagaaaaagcttcaaacactgcagagtgaaaattcgaacctcaggaaacaggccacc
accaatacatgtcaggtgcaaactggttctgagtacccagatacttccaaccactcttcc
ttaaagcgacgtccgtctgctcggggcagtcggcccatgtccatgtatgagacgggatca
ggtcagaacccgtatctcccaatgggagaggcgagccaccccgaggagagcaggacgaga
ctgcagcccttcccggcacacgcctccaggctggagaagcagaacagcacacccgagagt
gactatgacaacacccccaacgacatggagccagatgacctggggtcaggccgcaaagga
cgtcaaaggagtatggtgtggccaggtgacagctcagtagcagacacagcagaaccccac
gcagccccaagccccagccttcccagcacggaagacgtcatacggaagacggaacagatc
accaagaacatacaagagctcttgagagcagcccaagaaaataaacatgacagttacgtg
ccctgctcagagaggatacacgtcgccgtgacagaaatggcagctttattccccaaaaaa
cccaggtctgacacggtgaagacttcccttcgtttgctgacatccagtgcctaccgtctg
cagtcagagtgcaagaaggccctgccgggggactccggctcgcccacggacgtccagcag
gtcacgcagcaggtcatccagtgcgcctacgacatcgccaaggccgccaagcagctggtc
accctcaccaccaaagagaacaacaactga

KEGG   Oryctolagus cuniculus (rabbit): 100349249
Entry
100349249         CDS       T03373                                 
Symbol
SMAP1
Name
(RefSeq) small ArfGAP 1
  KO
K12486  stromal membrane-associated protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349249 (SMAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349249 (SMAP1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100349249 (SMAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100349249 (SMAP1)
SSDB
Motif
Pfam: ArfGap SR-25 EMC3_TMCO1
Other DBs
NCBI-GeneID: 100349249
NCBI-ProteinID: XP_002714575
Ensembl: ENSOCUG00000017134
UniProt: G1TD28
LinkDB
Position
12:57346685..57542454
AA seq 469 aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAVTNISSSDAPLQPLVSSPSLQTAAEKNKLEKEKEKKKEDKKREKE
PEKPAKPLTTEKLQKKEDQQLEPKKSTSPKKAAEPTVDLLGLDGPAEAPVTNGNTSTVPA
LNDDLDIFGPMISNPLPATVMPPAQGTPSVPAAATLSTVTSGDLDLFTEQATKSEEVAKK
QLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGN
VMGQSASMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQTQ
WSLSQMNQQMAGMSISSPSPTPGFGQPPNTTAGWSGSSSGQTLSTQLWK
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcgacacgttcctgccgggagaaagctcagaagctgaacgagcagcaccagctcatc
ttatccaaactgctgagggaggaagacaacaagtactgcgccgactgcgaggccaaaggt
cctcgatgggcttcctggaatattggtgtatttatttgcatcagatgtgctggaattcat
agaaatcttggggttcatatatccagggtcaagtcagtcaacctagatcaatggacacca
gaacagatacagtgcatgcaagatatgggaaatactaaagcaagactactttacgaagcc
aatcttccagagaactttcgaagaccacagacagatcaagcggtggaatttttcatccga
gataaatatgaaaagaagaaatactacgataaaaatgctatagctgttacaaatatttcc
tcctctgatgctcctcttcagcctttggtgtcctctccttctctgcaaactgctgctgag
aaaaacaaactggagaaagaaaaggaaaaaaaaaaggaagacaaaaagagagaaaaggag
ccagaaaagcctgcaaagccacttacaactgaaaagctgcagaagaaagaagatcaacaa
ttggagcctaaaaaaagtaccagccctaaaaaagctgcagaacccactgttgatctttta
ggactggatggccctgctgaggcaccagtgaccaatgggaacacaagcacagtaccagcc
ctgaatgatgacctggacatctttgggccaatgatttctaatcccttacctgcaactgtc
atgcccccagctcaggggacaccctctgtaccagcagctgccaccctgtctacagtaaca
tctggggatctggatcttttcaccgagcaagctacaaaatcagaagaagttgcaaagaaa
cagctctctaaagactccatcttatctctgtatggtacaggaaccattcagcagcaaagt
actcctggtgtgtttatgggacccacaaatataccatttacctcacaagccccggctgca
tttcaaggttttccatcaatgggtgtacctgtgcctgcagctcctggccttattggaaat
gtgatgggacagagtgcaagtatgatggtgggcatgccgatgcccaatgggtttatggga
aatgcacaaactggtgtgatgcctcttcctcaaaatgtggttggcccccaaggaggaatg
gtgggacagatgggtgcaccccagagtaaatttggcttgccacaagctcagcagacacaa
tggagcctctcacagatgaatcagcaaatggctggcatgagtatcagtagtccaagccct
acacctggttttggccagcccccgaacacaacagcaggatggtctggaagttcatcgggt
cagactctcagcacacaactgtggaaatga

KEGG   Oryctolagus cuniculus (rabbit): 100351262
Entry
100351262         CDS       T03373                                 
Symbol
AGAP3
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351262 (AGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351262 (AGAP3)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100351262 (AGAP3)
SSDB
Motif
Pfam: ArfGap PH Ank_2 Ank_4 Ank Ras Ank_5 PH_6
Other DBs
NCBI-GeneID: 100351262
NCBI-ProteinID: XP_017201148
LinkDB
Position
13:12530466..12558831
AA seq 682 aa
MVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVAL
RKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQASNGGGSAFSDYSSSVPSTPSISQR
ELRIETIAASSTPTPIRKQSKRRSNIFTSRKGADLDREKKAADGKVDSIGSGRAIPIKQG
ILLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLP
RATPTTAPGTSPRANGLPMERSHTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPEGL
HQRSCSVSSADQWSEATALSPGMQHPASDPAEGLGSSPKLEPPPSPHSNRKKHRRKKSTG
TPRPDGPSSAAEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRS
AKDKARLGNQNTALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGA
HLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALDGYAKPGPEACREEKERWIRAKY
EQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLS
SAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILLQHGCPGEGCSLAPA
SGRDPANGPNPSAELHRSPSLL
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggtgctggtgggcacgcaggacgccatcagtgccgccaatccccgggtcattgacgac
agcagagcccgcaagctgtccacagacctgaagcgctgcacctactacgagacgtgcgcc
acctacgggctcaacgtggagcgcgtcttccaggacgtggcccagaaggtggtggccttg
aggaagaagcagcagctggccatcgggccctgcaagtccttgcccaactcacccagccac
tcggccgtgtctgctgcctctatcccagctgtgcacatcaaccaggcctcgaatggcggc
ggcagcgccttcagcgactactcctcctcagtcccctccacccccagcatcagccagcgg
gagctgcgcatcgagaccatcgccgcctcctccacccccacacccatccgcaagcagtcc
aagcggcgctccaacatcttcacgtctcggaagggcgctgacctggacagagagaagaag
gctgcagacggcaaggtggacagcatcgggagcggccgggccatccccatcaagcagggg
atcctgctgaagcggagtggcaagtccctcaacaaggagtggaagaagaagtatgtgacg
ctgtgtgacaacgggctgctcacctaccaccccagtctgcatgattacatgcagaacatc
cacggcaaggagatcgacctgctgcggacaacggtgaaggtgcccggcaagcgcctgccc
cgagccacgcccaccacagccccgggcaccagcccccgtgccaacgggctgcccatggag
cggagccacacgcagctaggtgggggcacaggtgccccccactcggccagcagcgcatcc
ttgcactctgagcgccccctcagcagctcagcctgggctggcccgcgccccgaggggctg
caccagcgctcctgctccgtttccagcgccgaccagtggagtgaggccactgccctgtcc
cccggcatgcagcaccctgccagtgacccagctgagggactcgggtccagccccaagctg
gagcctcccccatctccccactccaaccggaagaagcaccgtcggaaaaagagcaccggg
accccccgaccagatggccccagcagtgctgccgaagaggccgaggagtcgtttgagttt
gtggtggtgtcgctcaccgggcagacgtggcacttcgaggcctccacggcggaagagcgg
gagctgtgggtccagagcgtgcaggctcagatcctggccagcctgcagggctgccgcagc
gccaaggacaaggctcgcctggggaaccagaacacagctctggctgtgcaggccgtccgc
accgtgcgcggcaacagcttctgtatcgactgcgatgcacccaatccagactgggccagc
ttgaacctgggcgccctcatgtgcatcgagtgctcggggatccaccgccacctgggagct
cacctgtcccgggtccgctccctcgacctggacgactggccgcccgagctgctggctgtc
atgaccgccatgggcaatgcccttgccaacagtgtctgggagggggccttggatggctat
gcaaaaccagggcctgaagcctgcagagaggagaaggagcgctggatccgagctaagtac
gagcagaagctgttcctggcgccgctgcccagctcggacgtgccgctggggcagcagctg
ctgcgggcggtagtggaggacgacctgcggctgctggtgatgctcctggcccacgggtcc
aaggaggaggtgaacgagacctacggggacggggacgggcgcacggccctgcacctctcc
agcgccatggccaacgtggtcttcacacagctgctcatctggtacggggtggacgtgagg
agccgggacgcccggggcctgacgccgctggcatacgcccgccgggccggcagccaggag
tgcgcggacatcctcctccagcacggctgccctggggagggctgcagcctggcccccgcc
tccggcagagatccagccaacggccccaacccctctgctgagctgcaccggagccctagc
ctcctatga

KEGG   Oryctolagus cuniculus (rabbit): 100351722
Entry
100351722         CDS       T03373                                 
Symbol
ARFGAP2
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 2
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351722 (ARFGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351722 (ARFGAP2)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100351722 (ARFGAP2)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 100351722
NCBI-ProteinID: XP_002709132
Ensembl: ENSOCUG00000002073
LinkDB
Position
1:complement(186537462..186549142)
AA seq 534 aa
MAAEPSKTEIQTLFKRLRAIPTNKACFDCGAKNPSWASITYGVFLCIDCCGVHRSLGVHL
SFIRSTELDSNWSWFQLRCMQVGGNANATAFFRQHGCTASDANSKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNVSSAPGHSPEKKDSDFFTEHTQPPAWDVPAAEPAGIQQPAPSA
ESSGLAQPEHGPNTDLLGTSPKAPLESMYLSAKGALPARELKSSIIGKKKPAAAKKGLGA
KKGLGAQKVSSQSFSEIERQAQVAEKLREQQVADAKKQAEESMVASMRLAYQELQLDRKK
EEKQLQNLEGKKREQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVTAKSSRSQLDLFDD
VGTFASGPPKYKDNPFSLGESFGSRWDTDTTWGMDRVEEKEPEVTISSIRPISERATNRR
DVESRSSGLESSEARQKFAGAKAISSDMFFGREVDVEYEARSRLQQLAGSSAISSSDLFG
DMDGAHGAGSVSLGNVLPSADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggcggcggaaccgagcaagaccgaaatccagactctttttaagaggcttcgcgcaatt
cccaccaacaaggcctgtttcgactgcggcgccaagaatccgagctgggccagcatcacg
tatggtgttttcttgtgcattgactgctgcggggtccaccgctccctgggcgtccatctc
agcttcatcaggtccacagagctggattccaactggagctggttccagctgaggtgtatg
caggtcggcgggaatgccaacgcgacagcctttttccgccagcacggctgcacagccagt
gatgccaacagcaaatacaacagccgagcagcccagatgtaccgggagaagatccggcag
ctggggagtgcggcgctggcccggcatggcactgacctctggatagacaacgtgagcagt
gctcccggccactccccagagaagaaggactcggatttcttcacggagcacactcagccc
cctgcctgggatgtgccagccgctgagcctgcagggatccagcagccagccccgtccgca
gagagcagtggcctggcccagccggagcatggccccaacaccgacctgcttggcacctcg
cccaaggcacctctggagtccatgtatctgtcagctaagggggcccttcctgccagagaa
ctgaaaagctccatcattgggaagaagaagccagcagcagctaagaaagggctgggtgct
aagaaaggcctgggcgcccagaaggtgagcagccagagcttcagcgagatcgagcggcag
gcccaggtggcagagaagctccgtgagcagcaggtggcggatgcgaagaagcaggccgag
gagtccatggtcgcctccatgcgtctggcctaccaggagcttcagcttgatcggaagaag
gaggagaaacagctccagaatctggaggggaagaagcgagagcaggcggagcggctgggc
atgggcttggtgagccggagctctgtgtcgcactcggtgctgtccgagatgcaggtgatc
gagcaggagaccccagtgaccgccaagtcctcccgctcgcaactggacctatttgacgac
gttgggacgttcgcctctggacccccaaagtacaaggacaaccccttttccttgggggaa
agttttggttcccgctgggatacggataccacttggggcatggacagggtagaggagaag
gagccagaagtgaccatctcgagcatccggcccatttcggaaagagccacaaaccggagg
gacgtggagagccggagctcgggcctcgagtccagcgaagcacgccagaagtttgcaggt
gcaaaagccatctcatctgacatgttctttgggcgggaggtggacgttgagtatgaagcc
aggtctcggctgcagcagctcgcgggcagcagcgccatcagctcttcagacctctttggg
gacatggatggagcccatggagcaggaagcgtgtctctgggcaatgtgctcccctcggcg
gacatcgcccagtttaagcagggtgtcaagtctgtggccgggaagatggctgtgctggcc
aatggcgtgatgaattctttgcaggatcgctacggttcctactga

KEGG   Oryctolagus cuniculus (rabbit): 100352233
Entry
100352233         CDS       T03373                                 
Symbol
ARAP2
Name
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
  KO
K18440  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352233 (ARAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352233 (ARAP2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100352233 (ARAP2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100352233 (ARAP2)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100352233 (ARAP2)
SSDB
Motif
Pfam: PH RhoGAP ArfGap PH_6 PH_11 SAM_1 PH_3 SAM_2 RA PH_8
Other DBs
NCBI-GeneID: 100352233
NCBI-ProteinID: XP_008273115
Ensembl: ENSOCUG00000015669
LinkDB
Position
2:complement(25721374..25928755)
AA seq 1708 aa
MSSVSEINVDIKDFLMSINLEQYLLHFHKFGFYTVKDCTTINDTVLHKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANIHKTKKNDDTSKDCHAPPSDRNTCREISNSDSTHKPSSTQL
EAVTQSLHQNDNGMEHSQSLKSDDKLSLPKRDFPVPDQEPRLNLGSSHDSSFGSENIKIE
SLIAKKTVDCTIEQQTEKVDSILETISKLPSIDPECLSSLGSSTSDANSVNGSNGLVEAS
PPSPFFQFQGEMVVNDLYIPSSPNLAPMRSRSKLVSRPSRSFLLRHRPVPEIPASTKGIS
GSYFRERRNVATSPGKSAAWQKDSSEEISSSIFPYGETFLFQRLENSKKRCVKNEFWAHE
ETLKGEANTAGNSFCIKSSIYDNRKEKISEEKVEDIWIPREDKNNLMIESASESEYSTVE
ECFQSLRRKNSKASRLRTQKALSLDPVNRHSYPLSSTSGNADSSGISSNAISPYACFYGT
SAKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEREMYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKTQSLTSQSQVVAAPEKCGYLELRGY
KAKIFTVLRGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSF
TAESEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCQAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIIIGNKRANDFWAGNLQKDEELHM
DSPVEKRKSFIIQKYKEGKFRKTLLASLTKEELNKALCAAVVTPDVLETMALLFSGADVM
CATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLSQEASQSTFLCDFL
YQAPAAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKE
DFYLNTGPIFVFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPFVAENLTETDYDLIG
QLFYKDCHALDQWKKGWFAMDKFNLRFCLQMQEVQEDRMHLRRLQELTISTMVQNGEKLD
VLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFV
TQYGLGCKYIYQKNGDPLHISELLENFKKDARSFKLRAGKHQLEDVTSVLKRFLSDIDDA
LLAKELYPYWISALDTQDDKERIKKYGAFIRTLPVVNQATLAAIIEHLYRVQKCSEINHM
NAHNLALAFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD
TQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKSDVWATFEV
IENEELERPLHYRENVLEQVLRWSSLAEPGSACLVVKRFLTVDTIEHCRERRALESIKEG
VLKIKEEPSKILSGNKFQDRYFVLRDGCLFIYKDSKSSKHEKMFSLSSMKFYLGVKKKMK
PPTSWGLTAYSDKHHWHLCCDSSQTQIEWMASIFIAQHENDIWPPAGQERKRSITKNPKI
GGLPLIPIQQERNTIQARKNIESARAELERLWLSEKRDREPVDSTLRDRASMVAHCLEHK
DDRFRNRTRKHRSLNCLEDTETEVPGQPKGLKGMKTLRKTEEKTSKAPVDSDHKLPSKVI
EELSVVLQRSRTLPKQLQDEHMMQKEIK
NT seq 5127 nt   +upstreamnt  +downstreamnt
atgtcctcagtcagtgaaataaatgttgatatcaaagatttcctaatgagtattaatttg
gagcagtatctcttacatttccacaagtttggtttttatactgtgaaggactgtacaaca
atcaatgatactgtgctacacaaaattggaatatcgcccacaggacaccgtaggagaata
cttaaacagttacagataatcttgtcaaagatgcaagatatcccaatatatgcaaatatt
cataaaacaaagaagaatgatgacacttcaaaggattgccatgctccaccttctgatcgg
aacacctgcagagaaatttctaactctgatagtactcacaaacctagctcaacacagttg
gaggctgttacacaaagtcttcatcaaaatgacaatggtatggaacatagccagtctctt
aaatcagatgataagctgtctcttcctaaacgtgacttccccgttccagatcaagaacca
cgcctgaatttgggttcttctcatgatagttcatttggtagtgaaaatattaaaatagaa
tctttgattgcaaagaagactgtggattgtacaattgagcaacaaacagaaaaagttgat
tcaatattggagactatcagcaagcttcctagtattgaccctgaatgtctttcttccctt
ggctcctcaacatcagatgcaaattctgtaaatggatccaatggcttagtagaagcatca
cctccatccccattctttcagtttcaaggagaaatggttgtgaatgatttgtacataccg
tcatcaccgaacttggcaccgatgagaagtcgcagcaagttggtttcgagaccatctcgc
tcttttctgctaagacatcggcctgtaccagagattccagcgtcaacaaaaggaatttca
ggaagctatttccgtgagagaagaaatgttgctacctcacctggaaaatctgcggcatgg
caaaaagattcaagtgaggagatttcatcttccatctttccttatggagagaccttcctc
ttccagagactggaaaattccaagaagagatgtgtgaagaatgaattttgggcccatgaa
gaaacactcaaaggggaggcaaatactgcagggaactctttctgtatcaaatcaagcata
tatgataacaggaaggagaaaataagtgaagaaaaagtagaagacatttggatacctcga
gaggataaaaacaatcttatgatagagtctgcctctgagtcagaatactcaaccgtggaa
gaatgcttccagagtttaagaagaaaaaattcaaaggcatcaaggttgaggacacagaaa
gcactgagcttggacccagtaaacaggcacagttaccccctaagctcaacaagtggaaat
gctgattcctcgggcatttcctcaaatgccatatctccctatgcctgtttttatggtacg
tctgcgaagaaggtcaagtcagggtggctggataagctttctcctcaaggaaaacgcatg
tttcagaagagatgggtgaaatttgatggccttagcatttcttactacaataatgaaagg
gagatgtattcaaagggaataattcccctttctgccatatcaacagtacgagttcaagga
gacaacaaatttgaagttgttacaacacaaagaacttttgtttttagagtagaaaaagaa
gaggagagaaatgactggatcagtatactgttaaatgcactgaaaacacagtcccttacc
tcacagtctcaagtggttgctgcacctgagaaatgtggatatcttgaattgagagggtat
aaagccaaaatttttactgtgctaaggggaaacagtgtgtggctttgcaaaaatgaacag
gattttaaaagtggattgggtatcaccatcattcctatgaatgtagcaaatgtaaagcaa
gtggacagaactgtgaaacaatcttttgaaataattactccctataggagtttcagcttt
acagcagagtctgaaaaagagaaacaagactggattgaagctgtgcagcaatcgatagca
gaaactctctctgattatgaagtagccgagaagatttggttcaatgagtccaacaggagc
tgtgcagattgtcaagccccggatccggactgggcatccatcaatctctgtgttgtcatc
tgtaagaagtgtgcagggcagcatagatccttgggaccaaaggattctaaggttaggagt
ctaaaaatggatgccagcatttggagtaatgaactgattgagctttttatcatcattgga
aacaaaagagcaaatgacttttgggctggtaatcttcaaaaggatgaagaattacacatg
gactcaccagtagaaaagcgaaaaagcttcattattcagaaatacaaagaaggaaaattc
agaaagacccttttggcatctctcaccaaagaagaattaaataaggctctgtgtgctgct
gttgtgacacctgacgttctggaaacgatggctttgctgttcagtggagcagatgtcatg
tgtgcaaccggagaccctgtgcatagcaccccttatttgctggccaagaaagctgggcag
agtctgcagatggaatttctttaccacaataaattctcagatttcccccaacatgacatt
cattctgagggtggattaagtcaagaggcctcccagtccacgttcctttgtgactttttg
tatcaagctcctgctgcagcttctaaactctcttcagagaaaaaactgcttgaagagacg
aataagaagtggtgtgttttggaaggaggtttcttgagttactacgaaaatgataagtcc
accacccctaacggcaccattaatatcaatgaagttatctgcctggctatacacaaagag
gacttctatttaaatactgggcccatctttgtttttgagatctacttaccttctgagcgt
gtgtttttatttggagctgaaacatctcaagctcaaagaaagtggacagaggcaatagcc
aagcattttgttccctttgttgctgaaaacttaacagaaactgactacgacttgattggc
cagctcttctacaaagactgccatgccctggatcagtggaaaaaaggctggtttgctatg
gacaaattcaatttgcgtttttgccttcagatgcaggaagttcaggaagacaggatgcac
ttaagaagactgcaagagttaacaatcagcacaatggttcaaaatggggaaaaattggat
gtcttacttttggtggagaaaggccgaacattatacatccatgggcataccaagttggat
ttcacagtctggcatacagcaattgaaaaagcagcaggtacagatggtaatgcattacaa
gatcagcagctcagcaaaaatgacgtccccattatcgtgaacagctgcatagcatttgtt
acacagtatggtttaggatgcaagtatatctatcaaaagaatggtgatcctttgcacata
agtgagctcttggaaaatttcaaaaaggatgcaagaagctttaaattgagggctggaaag
catcaacttgaagatgtgacgagtgtgttgaaacgttttctttctgacatcgatgatgca
ctgcttgccaaggagctctatccatactggatctctgctttagatacacaggatgacaag
gaaagaattaaaaagtatggagcatttatacgtactctcccagttgtcaaccaagcgaca
ttggcagctataattgaacacctttacagggttcagaaatgctcagaaatcaatcacatg
aatgcccataatttggccttggccttttcttcctgtttgtttcaaactaaaggacaaact
agtgaagaagtgaatgtaattgaggacctcattaataactatgttgaaatatttgaggtt
aaagaagatcaagtcaaacaaatggacatagagaatagctttattaccaagtggaaagac
actcaagtttcccaggctggagatttgctaattgaagtgtatgtagaaaggaaggaacct
gactgtagtattataatccggatatctcctgtgatggaagcagaagaattgactaacgat
atattggcaataaaaaatatcatccctacaaaaagtgatgtttgggccacatttgaagtt
attgaaaatgaagaacttgagcgccccctccactacagagagaacgtgctggagcaggtc
cttcggtggagttctctagctgagcctggctctgcgtgtcttgtggtgaagagattctta
actgtggacacaatcgagcactgtagagagaggcgtgccctggaaagtatcaaagaagga
gtcttaaaaatcaaagaagaaccatctaagatactgtctggaaataagtttcaagaccgg
tattttgttttacgagatgggtgtctctttatttacaaagactcaaagagtagtaaacat
gaaaaaatgttttctctcagctccatgaagttttatcttggagtgaaaaagaaaatgaag
cccccaacaagttggggattgactgcatattctgacaaacatcactggcacctgtgttgt
gacagttcacaaactcagattgagtggatggccagtatctttattgctcagcatgaaaat
gatatatggccaccagctggacaggaacgaaaacgttcgataaccaaaaatcccaaaatc
ggaggtttgcctctgattcccatccagcaggagagaaatacaatccaagcccggaaaaat
attgagagtgcaagggcagaactggaaaggctgtggctcagtgagaagcgtgatcgagag
cctgtggactccaccttaagggaccgagcctccatggtggcccactgcctagagcacaag
gacgacaggttccggaatcgcaccaggaagcatcgaagcctcaactgcctggaggacaca
gagacagaagtccccgggcagccaaaaggccttaaaggcatgaagacattgagaaagact
gaggagaagactagcaaagcccctgtggactctgatcataagttaccatcaaaggtgatt
gaagaactcagtgtggttctacagcggtctagaacccttccaaaacagttacaagatgaa
cacatgatgcagaaggaaataaaatga

KEGG   Oryctolagus cuniculus (rabbit): 100353577
Entry
100353577         CDS       T03373                                 
Symbol
ASAP2
Name
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100353577 (ASAP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100353577 (ASAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100353577 (ASAP2)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100353577 (ASAP2)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 SH3_1 Ank SH3_2 Ank_5 Ank_4 Ank_3 BAR PH_9 PH_13 STN1_2
Other DBs
NCBI-GeneID: 100353577
NCBI-ProteinID: XP_008248219
Ensembl: ENSOCUG00000003719
LinkDB
Position
Un
AA seq 1009 aa
MPEQLSVAEFLAVTAEDLGSPVGAAAFAAKMPRCRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNM
NNIISFPLDSLLXGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEIS
GAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVE
SLKPSIETLSTDLHTIKQAQDEERRQLMQLRDILKSALQVEQKESRRDSQIRQSTAYSLH
QPQGNKEHGTERSGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQV
KANPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDSAGENNIV
QELTREIISDVRRMPGNAVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSL
TLDVLGTSELLLAKNIGNAGFNEVMECCLPAGDSIKPNPGSDMNARKDYITAKYIERRFA
RKKHADNAAKLHSLCEAVKARDVFGLLQACADGVDLTEKIPLANGHEPDETALHLAVRSV
DRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNNECLKLLLRGKASIEIANEAGET
PLDIARRLKHEHCEELLNQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRR
EDRPVSFYQLGSGQLPSSVASLARDAASLAKDKQRGFGPSVLQNETYGAILSGSPPPAQP
AVPSTTSAPPLPPRNVGKVQAASANALWKTNSASVDGGSRQRSSSDPPAVHPPLPPLRVT
STNPLTPMPPPPVARTPSVIEALSQPSKPTQPGVSQSKAPPLPPQPPSRLPQKKPAPGAD
KSTLPTSKGQSRGPGELSGTEALGPLSNAVVLQPPAPMPRKSQATKAKPKRVKALYNCVA
DNPDELTFSEGDVIVVDGEEDQEWWIGHIDGDPSRKGAFPVSFVHFIAD
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgcccgagcagctcagcgtcgcagagttcctggccgtcaccgcggaggacctcggctcc
ccggtcggggccgccgccttcgccgccaagatgccccggtgccggggggcggcgctggcg
cgcgaagagatcctggagggagaccaggccatcctgcagagaatcaagaaggcggtgcgg
gccatccacagctctggccttggccacgtggagaacgaggagcagtacacgcaggcgctg
gagaagttcgggggcaactgtgtgtgcagagacgacccggatctgggcagcgccttcctc
aagttctccgtgttcaccaaggagctgacggcgcttttcaagaacctgattcagaacatg
aacaacatcatctccttccccctggacagcttgctgnaaggggacctgaagggggtcaaa
ggggatctgaagaagccttttgacaaagcgtggaaggactatgaaacaaaaataaccaag
atagagaaggagaagaaggagcacgccaagctccacgggatgattcgcaccgagatcagc
ggcgctgagatcgcggaagagatggagaaggagaggcggttcttccagctgcagatgtgc
gagtatctgctgaaggtcaatgaaatcaagattaaaaagggagtggatttgcttcagaat
ctgatcaaatattttcatgcccagtgcaattttttccaggatggactgaaagcagtggaa
agcctcaagccttccatcgaaacgctctcaaccgatcttcacacgatcaaacaggcccag
gatgaagagaggcggcagctgatgcagctccgagatattctgaagtcagcgttgcaggtg
gagcagaaggagtctaggagagactcccagatccgccagagcacggcctacagcttgcac
cagcctcagggcaacaaggagcacggcacagagcgcagcggcagcctgtacaagaagagc
gatgggatccggaaggtgtggcagaagaggaagtgctccgtgaagaatggctttctgacc
atctcgcacgggaccgcgaaccggccgccggcgaagctcaacctcttgacgtgccaagtg
aaggccaaccccgaggagaagaagtgcttcgaccttatctcacatgacaggacgtaccac
ttccaggcagaggacgagcaggaatgtcagatatggatgtccgtgctgcagaacagcaaa
gaggaggccttgaacaacgcgttcaagggggacgacagcgccggcgagaacaacatcgtg
caggagctgaccagggagatcatctccgacgtccggaggatgccgggcaacgccgtgtgc
tgcgactgcggggcgccggatcctacgtggctttccaccaacctgggcattctgacctgc
atcgagtgttccggaatccaccgcgagctgggagttcactactccaggatgcagtccctc
accttggacgtgctggggacgtccgagctgctgctcgccaagaacatcgggaacgcgggc
ttcaatgaggttatggagtgctgcctgccggccggggactccatcaaacccaacccgggc
agcgacatgaatgcaaggaaggactacatcacggccaagtacatcgagaggagattcgcg
cgcaagaagcacgcagacaacgcagccaagcttcatagcctgtgcgaggccgtcaaggcc
cgagacgtgttcgggttactccaggcctgtgccgacggtgtggacctcacagagaaaatc
ccactggccaacggccacgagccggacgagacggcgctccacctggccgtcagatccgtg
gaccggacttctctccacatcgtggactttttggttcagaacagcgggaacctggacaag
cagaccggcaagggcagcacggccctgcactactgctgtctgaccgacaacaacgagtgt
ctcaagctgctgctgcggggcaaggcctccatcgagatagcaaacgaggccggggagaca
ccgctggacatcgccaggcgcctcaaacacgagcactgtgaagagctgctgaaccaggcc
ctgtctggaaggttcaattcccacgtccacgtggaatatgagtggcggctgctgcacgaa
gacctggacgaaagtgatgacgacatggacgagaagttgcagcccagtcccaaccggcgg
gaggaccggcccgtcagcttctaccagctgggatctggccagcttccgtccagcgtggcc
tcgttggccagagacgccgccagcctcgccaaggacaagcagcggggcttcgggcccagc
gtcttgcagaacgagacctatggcgccatcctgagcggcagcccgccccccgcccagccg
gcagtccccagcaccaccagcgccccccctctgccccctcggaacgtcggcaaagttcag
gcagcctcagctaacgccctgtggaagacaaactccgcgagcgtggacggtggaagcagg
cagcggtcttcgtcagatccgccagccgtccacccaccgctgccccctctccgcgtcacg
tctaccaatcccctgaccccgatgccaccccctccggtagccaggacgcccagcgtgatt
gaagccttgagccagcccagcaagcccacccagccgggggtgtcacagagcaaagccccg
cccctgccgccccagccccccagccgcctcccccagaagaagccagctcccggggctgac
aagtcaaccctgccgaccagcaagggccagtccaggggacctggagaactctctggaacg
gaagctctgggtcctctgtccaatgccgtggtcctgcagccgccggcgcccatgcccagg
aagtcacaggcgaccaaggcgaagcccaagcgggtgaaggcgctgtacaactgcgtggcg
gacaacccggacgagctgaccttctccgagggcgacgtgatcgtcgtggacggcgaggag
gaccaggagtggtggatcggccacatcgacggagaccccagtcgcaagggagcgttcccc
gtgtcattcgtgcacttcatcgccgactga

KEGG   Oryctolagus cuniculus (rabbit): 100354264
Entry
100354264         CDS       T03373                                 
Symbol
ARAP3
Name
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3
  KO
K12490  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100354264 (ARAP3)
   04024 cAMP signaling pathway
    100354264 (ARAP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100354264 (ARAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100354264 (ARAP3)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100354264 (ARAP3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100354264 (ARAP3)
SSDB
Motif
Pfam: RhoGAP PH ArfGap RA PH_6 PH_8 PH_11 PH_3 PH_2
Other DBs
NCBI-GeneID: 100354264
NCBI-ProteinID: XP_017196629
Ensembl: ENSOCUG00000009340
LinkDB
Position
3:complement(23712035..23740223)
AA seq 1462 aa
MEPSPSLDAPAQTPKPVPKPRTVFGGLTGPATTQRPGPSPTFRGPEVSRSPESSPKSPPL
PTSSSGQPSSSDMVEMMPNAIYFGLDLRGGAQAAQDMAPDSSQKAAPTPALRPATGTVHI
MDPGCLYYGVQPVGAPGATDRREGRGVCQDRAEHRLSRQDLEAREDAGYASLELPGDSTL
SLPTLDTEETSDDLISPYASFSSTADPPTPLLSGWLDKLSPQGNYVFQRRFVRFNGRSLM
YFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQIITGQRVFVFRTESEAQRDTWCSTLQSCL
KELHLLGSPRPPQLPRPLRTGMLELRGHKAKVFAALSPGELALYKSEQAFSLGIGICFIE
LQGCSVRETKSRGFDLLTPHRCFSFTAESGGARQSWAAALQEAVTETLSDYEVAEKIWSN
RANRHCADCGAPRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQL
FITLGNDRANRFWAGALPPGEGLHPDSTPGSRGEFISRKYRLGLFRKSHPQCPDHGQLLQ
ALCAAVAGPNLLKNMTQLLCVDATEGEESWSPSALNGSCPGLLPSDPSPGVYNEVVVPAT
CSSFLYCGPVSNKAGPPPPRRGRDAPPRLWCVLGAALEMFASESSSEPLSLIQPQDVVCL
GVSPPPADPGDMDRLPFSFELILTGGRIQHFGTDGADSLEAWTSAVGKWFSPLSCHQLLG
PGLLRLGRLWLRSPSHTALAPGLWLSAFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQE
ISVVPAADTPDKKEHLVLVETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSR
GDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDV
TDTLKRFFRELDDPVTCARLLPRWREAAELPQKNQRLEKYREVIGCLPRVNRRTLAALIG
HLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYVCVFDIDADQVA
QIELEVNLITTWKDVQLSQAGDLIMEVYLEQQLPDNCVTLKVSPTLTAEELTNQVLEMRG
TAAGTDLWVTFEILEHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKVSLARASCL
FTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLKEKKSSKPEREWPLEGA
KVYLGIRKKLKPPTPWGFTLILEKLHLYLSCTDEDEMWDWATSILKAQHDDQQPVVLRRH
SSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEEQE
EVEEPVYEEPVYEEVGAFPELTGDTLSSFSSTQEWAATPDTPLTSQRSFDQPPASKANTL
GQEEGPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGDTTACLGSPPPPSPTGPPP
QTPGFPTHSPHSSSLPSSQPFT
NT seq 4389 nt   +upstreamnt  +downstreamnt
atggagccgtcccccagcctggacgccccagcccagactcccaagcctgtgcccaagccc
aggacagtgtttggtgggctcactggccctgccaccacccagagacctgggccgagccca
accttccggggcccagaagtgtccaggagtccagagtccagcccgaagtcccctccactc
cccacctcctcctctgggcagccatcatcctcagatatggtggagatgatgcccaatgcc
atctacttcggcctggacttaagaggcggggcccaggcagcccaggacatggccccagac
agctcccagaaagctgcccccacccctgccttgagacctgccacaggaacagtgcacatc
atggatcccggttgcctgtattatggtgtccagcctgtgggggcaccaggggccactgac
agaagagagggcagaggtgtctgccaggacagggctgaacacaggctcagcaggcaagac
ctggaagcacgggaggatgctggctatgctagccttgagctgcccggggactccacactc
tcactgcccacactggacacggaggagaccagtgatgacctcatttcaccctatgccagc
ttctcttccacggcagacccgcccacgcccctgctcagtggctggctagacaagctgtcc
cctcaggggaactatgtcttccagagacgctttgtgcggttcaatgggcggagtctcatg
tactttggcagtgacaaggaccccttccccaagggtgtgatccctctgacggccattgag
atgacccgcagcagcaaggacaacaaattccagatcatcactggccagagggtattcgtg
ttccgcacagagagtgaggctcagcgggacacgtggtgctccacgctgcagtcctgcctg
aaggagctgcacctcctggggtccccccggcccccccagctgccgcgacccctccgcaca
ggcatgctggaactccgcggacacaaggccaaggtgtttgctgccttgagccctggagag
ctggcactgtacaagagtgagcaggccttctctctgggcatcgggatctgcttcatcgaa
ctacaaggctgcagcgtccgggagaccaagagtcgaggcttcgacttgctcacacctcat
cgttgcttcagcttcacagccgagtctgggggggctcggcagagctgggcggccgctctg
caggaagcagtaaccgagaccctgtctgactacgaggtggctgagaagatctggtccaat
cgggcaaaccggcactgtgcggactgtggggccccccgcccggactgggctgccgtcaac
ctgggcgtggtcatctgcaagcagtgtgcgggtcagcatcgggccttgggttctgggatc
tccaaggtgcagagcctgaagctggacacgagtgtctggagcaatgagatagtacagtta
ttcatcaccctgggcaatgatcgtgccaaccgcttctgggcaggggcgctacccccaggc
gaggggctgcacccagactcgacccctggctcccggggagagtttatctcccggaagtac
cggctgggtctcttccggaagtcccaccctcagtgtcctgatcatggccagctcctccag
gcactgtgtgcagctgtggccggccccaacctgctgaaaaacatgacccagctcctctgt
gttgatgccactgagggcgaggagtcctggtctccttcagccctcaatggcagctgccct
ggccttctaccctcagacccctcgcctggtgtgtacaatgaggtggtggtgcccgccact
tgcagcagcttcctgtactgtggtcccgtcagcaacaaggctggaccccctccccctcgc
aggggccgggatgctcccccccgcctgtggtgtgtgctgggagcagctctggaaatgttt
gcttccgaaagcagctctgaacccctcagcctcatccagccccaggatgttgtgtgtctg
ggcgtgagccccccacccgctgaccccggtgacatggacaggctccccttttcctttgag
ctcatcctcactgggggaaggatccagcactttggcacggatggagcggacagtctggag
gcctggaccagtgccgtgggcaagtggttctccccactgagctgtcaccagctgctgggc
cctggtctgctgcggctgggccgcctgtggctgcgctccccctcccacacagccttggcc
cccggcctctggctgtcggcattcggcctccttcgtggtgatcacctcttcctgtgtcca
gctccgggccccggccccccggccccagaggacatggtgcatctccggcggctgcaggag
atcagtgtagtccctgcagctgacaccccagacaagaaggagcatttggtcctagtggag
acaggaaggaccctgtacctgcagggagagggccgcctggactttgcagcatggaacaca
gccattgggggagcagccggtgggggcggcacagggctgcaggagcagcagatgagccgg
ggggacatccccatcattgtggacgcctgcatcagttttgtcacccagcatgggctccgg
ctggagggtgtgtaccggaaagggggcgcccgcgcccgcagtctgcgactcctggctgag
ttccgcagggacgcccggtccgtgaagctccgcccaggggagcacttcgtggaggacgtc
actgacacgctcaaacgcttctttcgagagctcgatgaccctgtgacctgcgcacggttg
ctgcctcgctggagggaggctgcggagctgccccagaagaatcagcgcctggagaaatac
agagaagtgatcggctgcctgccgcgggtcaaccgccggacactggctgccctcattggg
catctctatcgggtgcagaagtgtgcggctctaaaccagatgtgcacccggaacctggcc
ctgctgtttgcacccagcgtgttccagacggacgggcggggggagcacgaggtgcgggtg
ctacaggagctcatcgatggctacgtctgcgtctttgatatcgatgctgaccaggtagct
cagattgagttggaagtcaatcttatcaccacctggaaggatgtgcagctgtcccaggct
ggagacctcatcatggaggtctacctagagcagcagctcccggacaactgtgtcaccctg
aaggtgtccccaacactgactgccgaggagctgactaaccaggtactggagatgcggggg
acagcagctggcacagacctatgggtgacgtttgagattctcgagcacggagagcttgag
cggccactgcaccccaaggagaaggtcctggagcaggccctacagtggtgccagctcccg
gagccctgctcagcctccctgcttttgagaaaagtctccttggcccgggccagctgcctt
ttcacaggtatccggcgtgagagtccacgcgtggggctgctgcggtgtcgtgaggagccg
ccccgcttgctgggaagccgcttccaggagaggttcttcctgctacgtggccgctgcctg
ctgctgctcaaggagaaaaagagctctaaaccagaacgggagtggcctctggaaggtgcc
aaggtctacctgggaatccgcaagaagttaaagccccccacgccatggggctttacgttg
atactggagaagctgcacctctacctgtcctgcactgatgaggatgagatgtgggattgg
gccaccagcatccttaaagcgcagcacgatgaccagcagccagtggtcttacgtcgccat
tcctcctctgaccttgcccgtcagaagtttgggactatgcctttgctgcccatccgtggc
gatgacagtggagccaccctcctctctgccaatcagaccctgcggcgactacacaaccgg
aggaccctgtccatgttctttccaatgaagtcatcgcaggggtctgtggaggagcaggag
gaagtggaggagcccgtgtacgaggagcccgtgtacgaggaggtgggggccttccccgag
ctgactggggacaccctgagctccttctccagcacacaggagtgggcggccacgccagac
accccccttaccagccagaggtcctttgatcaaccccctgcctccaaagcgaacaccctg
ggccaggaggaggggccgcctgagccccctccgggccccccttcaaagagcagtccccag
gcccgggggtctctggaggagcagctgctccaggagctcagcagcctcatcctgaggaag
ggggacaccactgcgtgcctgggaagccccccgccccccagccccactgggcctccccca
cagacaccgggcttccccacacacagcccgcattcttccagcctgccctccagccagccc
ttcacatga

KEGG   Oryctolagus cuniculus (rabbit): 100359236
Entry
100359236         CDS       T03373                                 
Symbol
ACAP1
Name
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100359236 (ACAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100359236 (ACAP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100359236 (ACAP1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100359236 (ACAP1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100359236 (ACAP1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100359236 (ACAP1)
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_5 Ank_2 Ank_4 Ank_3 PH_11
Other DBs
NCBI-GeneID: 100359236
NCBI-ProteinID: XP_002718855
Ensembl: ENSOCUG00000015300
UniProt: G1T956
LinkDB
Position
19:complement(11802309..11815063)
AA seq 740 aa
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRQYLASSRAFI
AGICDLARLGPPEPMMAECLEKFTVSLSHKLDSHAEFLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALTHNAEVPRRRVQDAEEAGAALRTARAGYQGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQAAHFQQGHEELSRLAQYRKELGAQLHQLVLNSARERRDMEQ
RHVVLKQKELGGDEPEPTLRQGPSGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIA
SAFSQARLEDSPRGPGQGSGHLAMGSAATLGCGGMARGREPGGVGHVAAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVV
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRSGRGAPRGHP
PIPPKPSIRPQQGSFRSKPEPPSEDLGNLHPGALLFRAAGHPPSLPTMADALAHGADVNW
VNGGQENATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgacggtcaagctggactttgaggagtgtctcaaggattcgcctcgcttccgagcctct
atcgagctggtggaagccgaagtgtcagaattggagacccgtctggaaaagctcctcaag
ctgggcaccggtctcctggaaagtgggcgccagtacctcgcctccagccgggccttcatt
gctggcatctgtgacttggcccgtctgggtccaccagagcccatgatggcggagtgcctg
gagaagttcaccgtgagcctgagccacaagctggacagccacgcagagtttctcgatgcc
acccaacacacactgcagcagcaaatccagaccctggtcaaggaaggtctccggggtttc
cgggaggcccgccgggacttctggcgaggggccgagagcctggaggccgctctgacccac
aacgcagaggtccccaggcgccgggttcaggatgccgaggaggctggagcggctctgagg
actgctcgggctgggtaccagggacgagcattggattatgccctgcagatcaatgtgatt
gaggacaagaggaagtttgacatcatggagtttgtgctgcgtttggtggaagcccaggcc
gcccatttccagcagggccacgaggagctgagccggctggcccaatatcgcaaggagctg
ggcgcccagttgcaccagctggtgttgaattcagcacgggaaaggcgggacatggagcag
aggcacgtagtgctgaaacagaaggaattgggtggggacgagccagagccaactctgagg
caggggcccagtggcctggtcatggaagggcacctcttcaaacgtgccagcaacgccttc
aagacctggagcagacgctggttcaccattcagagcaaccagctggtttatcagaagaag
tacaaggaccctgtgaccgtggtggtggacgaccttcggctctgcacggtgaagctctgc
ccagactcagaaaggcggttctgctttgaagtggtgtctaccagcaagtcctgcctcctc
caggctgactccgagcgcctcctgcagctgtgggtcagcgctgtgcagagcagcattgcc
tcggccttcagccaggcgcgccttgaagacagcccgaggggtccaggccagggctcagga
cacctggccatgggctctgctgccaccctgggctgtggcggcatggccagggggagggag
cctgggggagtcggacatgtggcagcccaggtgcagagcgtggacggcaacgcccagtgc
tgcgactgccgagagccagccccagaatgggccagcatcaacctcggtgtcaccctgtgc
attcagtgctccggcatccacaggagccttggggttcatttctccaaagtccgctccctg
actctcgactcatgggaaccggaactagtgaagctcatgtgcgagctgggaaatgtggtc
atcaaccagatctatgaggcccgcgtggaggccatggcagtgaagaagccagggcccagc
tgctcccggcaggagaaggaggcctggattcatgccaagtatgtggagaagaaattcctg
accaagctccctgagattcgagggcgaagaagtggccggggggcccctcggggacaccct
cctatacctccaaagccttccatcaggccccagcaggggagtttcagatccaagccagag
cccccgtctgaggacctgggaaacctgcaccctggggccctgctgtttcgagctgctggg
cacccaccatccctccccaccatggccgatgcccttgcgcacggagctgacgtcaactgg
gtcaacgggggtcaggagaatgcgacgccactgatccaggccacagctgctaattctctt
ctggcctgtgagtttctcctgcagaacggggcgaacgtgaaccaggcagacagtgcgggc
cgagggcccctgcaccacgctaccattcttggccacactgggcttgcctgcctgttcctg
aaacggggggccgacctgggggcccgggactctgaaggcagggaccctctgaccatcgcc
atggaaacagccaacgctgacatcgtcaccttgctacgcttggcaaagatgagggaggcc
gaggccgcccagggccaggcaggagatgagacgtatctcgacatcttccgggacttctcc
ctaatggcgtcagacgacccggagaagctgagccggcggagtcacgacctccacacgctc
tga

KEGG   Oryctolagus cuniculus (rabbit): 100359279
Entry
100359279         CDS       T03373                                 
Symbol
ASAP1
Name
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100359279 (ASAP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100359279 (ASAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100359279 (ASAP1)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100359279 (ASAP1)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 BAR SH3_1 Ank SH3_2 Ank_4 Ank_3 Ank_5 PH_3
Other DBs
NCBI-GeneID: 100359279
NCBI-ProteinID: XP_017197021
Ensembl: ENSOCUG00000002414
LinkDB
Position
3:complement(145816581..146155468)
AA seq 1141 aa
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQILDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKIADKLKQYTEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEHHARTVLQSRRDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCVV
KNGILTISHATSNRQPAKVNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWVS
VLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRIPGNDVCCDCGSSEPTWLSTNL
GILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPK
PTPSSDMTVRKEYITAKYVDHRFSRKTCSSAAAKLNELLEAVKSRDLLALIQVYAEGVEL
VEPLLESGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSLYGK
PECLKLLLRSKPTMDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKINPHVHVEYEWNL
RQEEMDESDDDLDDKPSPVKKERSPRPQSFCHSSSISPQDKLTLSGFSTPRDKQRLSYGA
FTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPP
PPPGHKRTLSDPPSPLPHGPPNKGAVPWGNDVGSSSSSKTANKFEGLSQQSSTSSAKTAL
GPRVLPKLPQKVALRKTETSHHLSLDKAGVPPEIFQKSSQLAELPQKPPSVDLSPKPTEL
APRPQIGDLPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQPGD
VAPKPPEVTQKAHPVDLSPNVQPKDAIQKQASEDSNDLITPTLPETPIPLPRKINTGKNK
VRRVKTIYDCQADNDDELTFIEGEVIVVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILS
D
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgagatcttcagcctccaggctctccagtttttcgtcgagagattcactatggaatcgg
atgccggaccagatctccgtgtccgagttcatcgccgagaccaccgaggactacaactcg
cccaccacgtccagcttcaccacgcggctgcacaactgcaggaacacagtcacgctgctg
gaggaggctttagaccaagatagaacagccctgcagaaagtgaagaagtctgtaaaagca
atatataattctggacaagatcatgttcaaaatgaagaaaactatgcccaaattcttgat
aagtttgggagtaattttttaagccgcgacaaccctgatcttggcaccgcttttgtcaag
ttttcaactctgacaaaggaattgtccacactgctgaaaaatctgctccagggcttgagc
cacaatgtgatcttcaccttggattccctgttaaaaggagacctaaagggagtcaaagga
gatctcaagaagccgtttgataaagcctggaaggattatgagacaaagtttacaaaaatt
gagaaggagaaaagagagcacgcaaaacagcacggcatgatccgcacggagataacagga
gccgagatcgcagaggaaatggagaaggaaaggcgtctgtttcagctgcagatgtgcgaa
tatctaattaaagttaatgaaatcaagaccaaaaagggcgtggatctgctacagaatctt
atcaaatattatcatgcacaatgcaatttcttccaggatggcttgaaaatagctgataaa
ctgaaacagtacactgaaaaattggctgctgacttatataatataaaacagacgcaggat
gaagaaaagaaacagttaactgcactccgagacttaataaaatcatctcttcaacttgat
cagaaagagcatcacgcccggactgttttacagtctaggagagattcccagagccggcaa
ggaggttacagcatgcaccagctccagggaaacaaggagtatggcagtgagaagaagggc
tacctactgaagaagagtgatgggatccggaaagtatggcagagaaggaaatgtgttgtc
aagaatgggattctgaccatctcacatgctacatccaacaggcaaccggctaaggtgaac
cttctcacctgccaagtgaaaccaaatgctgaggacaagaagtcttttgacctgatatca
cataatagaacgtatcactttcaggcagaagatgaacaggattatgtagcgtgggtatca
gtattgacaaacagcaaggaagaggccctaaccatggccttccgtggagagcagagcaca
ggagagaacagcttggaggacctgaccaaggccattatcgaggatgtgcagcggattcct
gggaatgatgtctgctgcgactgtggctcttcagaacccacctggctttcaaccaacttg
ggtattttgacctgtatagaatgttccggcatccatagagaaatgggggttcacatttct
cgcattcagtctttggagctagacaaattaggaacttctgaactcttgctggccaagaat
gtggggaacaatagttttaatgatattatggaagcaaatttacccagtccctcacctaaa
cccaccccttccagtgatatgactgttcgtaaggaatatatcactgcaaaatatgtggat
cacaggttttcaaggaagacctgctcatcagcagcagcgaaactgaatgaactgcttgag
gctgtcaaatccagggatttacttgcactaattcaagtctatgcagaaggagtggagctc
gtggagccactcctggaatcaggacaggaacttggagagacagcccttcatcttgcagtc
cgaactgccgaccagacatctctccatttagttgactttcttgtacaaaactgtgggaac
ctggacaagcagacggccctggggaacacagtcctccactactgtagtctctatggtaaa
cctgagtgtctgaagctgcttctcaggagcaagcccaccatggacatcgtgaaccaggct
ggagaaactgccttggacatagcaaagagactaaaagctacccagtgcgaagatctgctt
tcccaagctaagtctggaaaaatcaatccacatgtccatgtggaatatgaatggaatctt
cgacaggaggagatggatgaaagtgatgatgatctggatgacaaaccaagccctgtcaag
aaagagcgctcacccaggccgcagagcttctgccactcctccagcatctccccacaagac
aagctgacgctgtcgggcttcagcactcccagggacaagcagcggctctcctacggagcc
ttcaccaaccagatcttcgtgtccactagcacagattcgcccacgtcaccaaccacggag
gcacctcctctgcctcctagaaacgccgggaaaggtccaactggcccaccttcaacactc
cctctaagcacccagacctctagtggcagctccaccctatccaagaagaggcctcctccc
ccaccacccggacacaagagaaccctgtccgaccctcccagcccactacctcatgggccc
ccaaacaaaggcgcagttccttggggaaacgatgtgggctcctcatcttcaagtaagact
gcaaacaagtttgaagggctctctcagcagtcgagcaccagttctgcaaagactgccctt
ggcccaagagttcttcctaaactacctcagaaagtggcactaaggaaaacggaaaccagc
catcatctgtccctggacaaagccggtgtcccgcctgaaatctttcagaaatcgtcacag
ttggcagagctgccacaaaagccaccatctgtagacctgtccccgaagccaacagaactg
gctcccaggccccaaattggagatctgccacctaagcccggagagctgccccccaagccc
cagctgggtgacctgcccccgaagccccagctctcagacttgcctcctaagccacagatg
aaggacctgccccccaaaccgcagctaggagacctgctggcaaagtcccagcctggagat
gtcgcgcccaagccgccggaggtcacacagaaggcgcacccagtagatctctccccaaat
gtgcagcccaaggacgccatccagaagcaggcctccgaagactccaatgacctcatcacg
cccactctgccagagacgccgataccactgcccagaaaaatcaacacggggaaaaataaa
gtgaggcgcgtgaagaccatttacgactgccaggcagacaacgatgatgagcttacgttc
atcgagggagaggtgatcgtcgtcacaggggaagaggaccaggagtggtggattgggcac
atcgagggacagcctgaaaggaagggggtctttccagtgtcctttgtccacatcctgtcc
gactag

KEGG   Oryctolagus cuniculus (rabbit): 103347442
Entry
103347442         CDS       T03373                                 
Symbol
ARFGAP3
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 3
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103347442 (ARFGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103347442 (ARFGAP3)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    103347442 (ARFGAP3)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 103347442
NCBI-ProteinID: XP_008252194
Ensembl: ENSOCUG00000024633
LinkDB
Position
Un
AA seq 490 aa
MGDPSKQDILTIFRRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNANASSFFHQHGCATSDTNAKYNSRAAQLYRERVKSL
ASQATRKHGTDLWLDSCVVPPSSPPPKEEDFFAAHASPEVSSPAWASAQPEPPPLTPKAA
ETAPGSSTGGLEPGPSVEGLNAPAKAAPEAPSLIKKKPNQAKRGLGAKKGSLGAQKLASS
CFEDIEKQARAADKRKEQEDGARAAPKEESIVSSLRLAYKDLEIQMKKEEKMNLSGKKRA
ESERLGMGFGTCRSGVSHSVTTDMQTIEQESPVLAKPRRKYTDDSDDSYFTSGSRYLDEP
PELRGSSFSSWDDSSDSPWKKESSRDVDTVLKASGYADSPAARRKPDCEPLDHTDEAQRK
FGNVKAISSDMYFGRQAQADYETRARLERLSASSAISSADLFEEQRKRPAGSYNLSSVLP
SAPDMAQFKQ
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgggggaccccagcaagcaggacatcctgaccatcttcaggcgcctccgctcggtgccc
accaacaaggtgtgcttcgactgtggcgccaagaaccccagctgggccagcataacctac
ggggtgttcctgtgcatcgactgctcgggctcgcaccgctcgctgggcgtccacctgagc
ttcatccggtctacggagttggattccaactggtcttggtttcagctgcgctgcatgcag
gttggagggaacgctaacgcctcttccttcttccatcaacacggctgtgccaccagtgac
accaacgccaagtacaacagccgcgccgctcagctctacagggagagggtcaagtcgctg
gcctcgcaagccacgcggaagcatggcaccgacctgtggctcgacagctgtgtggtcccg
ccttcgtccccgcccccaaaggaggaagacttttttgctgctcacgcctctcctgaggtg
agcagcccagcctgggcatcggcacagccagagccacctcccctaacaccgaaggccgcg
gagaccgcgcccgggagcagcacaggcgggctggaacccggaccaagcgtggaaggcctc
aacgccccggcaaaggccgccccagaggcgccctctctcatcaaaaagaagccaaatcaa
gctaaaagaggactcggggccaaaaagggaagcttgggagcccagaaactggcgagttcg
tgcttcgaggacattgaaaagcaagctcgggctgccgacaagaggaaggagcaggaagac
ggggccagggcggcacccaaggaggagtccatcgtctcgtcactgcgcttggcctacaag
gaccttgagattcaaatgaagaaagaggagaagatgaacttgagcgggaaaaagagagcc
gaatcggagagactgggcatgggctttggaacctgcagaagtggcgtttcacattcagtg
accacggacatgcagaccatagagcaggagtcgccagtcctggcaaagccacggagaaag
tacaccgacgacagcgacgactcctacttcacttccggctcaaggtacttggacgagccg
ccggagctgaggggtagctctttctccagctgggacgacagctccgattccccctggaaa
aaggagagcagcagagacgtggacacggtgctcaaggccagcggctacgcagacagcccc
gccgctcgccgcaagccagactgtgagcccctggaccacacggacgaggcccagaggaag
ttcggcaacgtcaaggccatttcatcagacatgtactttgggagacaagcccaggctgat
tacgagaccagggcgcggctggagaggctctcggccagctcggccatcagctcggcggac
ctgttcgaggagcagaggaagcggccggcagggagctacaacctgtccagcgtgctgccc
agcgcccccgatatggcgcagttcaagcag

DBGET integrated database retrieval system