KEGG   Oryctolagus cuniculus (rabbit): 100008984
Entry
100008984         CDS       T03373                                 
Symbol
CCL4, ACT2
Name
(RefSeq) chemokine (C-C motif) ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100008984 (CCL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100008984 (CCL4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100008984 (CCL4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100008984 (CCL4)
   04623 Cytosolic DNA-sensing pathway
    100008984 (CCL4)
   04062 Chemokine signaling pathway
    100008984 (CCL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100008984 (CCL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100008984 (CCL4)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100008984 (CCL4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100008984
NCBI-ProteinID: NP_001075665
Ensembl: ENSOCUG00000026206
UniProt: P46632
LinkDB
Position
19:25035471..25045636
AA seq 92 aa
MKLGVTVLSVALLVAALCPPALSAPMGSDPPTACCFSYTLRKLPRHFVIDYFETTSLCSQ
PAVVFQTKKGRQVCANPSESWVQEYVDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagctcggcgtgaccgtcctctctgtcgccctgctggtggccgccctctgccctccc
gcactctctgcaccaatgggctcggacccccccaccgcctgctgcttctcgtacaccctg
cggaagcttcctcgtcacttcgtgatagattacttcgagaccaccagcctctgctcccag
ccagctgtggtattccagaccaaaaagggcaggcaagtctgtgccaaccctagcgagtcc
tgggtccaggagtacgtggatgacttggaactgaactga

DBGET integrated database retrieval system