KEGG   Oryctolagus cuniculus (rabbit): 100008999
Entry
100008999         CDS       T03373                                 

Symbol
CD86
Name
(RefSeq) CD86 molecule
  KO
K05413  CD86 antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04620  Toll-like receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05202  Transcriptional misregulation in cancer
ocu05320  Autoimmune thyroid disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100008999 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100008999 (CD86)
   04672 Intestinal immune network for IgA production
    100008999 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100008999 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100008999 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100008999 (CD86)
   05323 Rheumatoid arthritis
    100008999 (CD86)
   05320 Autoimmune thyroid disease
    100008999 (CD86)
   05330 Allograft rejection
    100008999 (CD86)
   05332 Graft-versus-host disease
    100008999 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100008999 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100008999 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100008999 (CD86)
   04090 CD molecules [BR:ocu04090]
    100008999 (CD86)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100008999 (CD86)
CD molecules [BR:ocu04090]
 Proteins
  100008999 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 C2-set_2 ig I-set KRAP_IP3R_bind DUF4307
Other DBs
NCBI-GeneID: 100008999
NCBI-ProteinID: NP_001075677
Ensembl: ENSOCUG00000011550
UniProt: P42071
LinkDB
Position
14
AA seq 330 aa
MDAGCTMGLSVTVFVMALLLSGAASLRIQAYFNKTADLPCQFTNSQSRSLSELVVFWQDQ
ERLVLYELFLGREKPDNVDPKYIGRTSFDQESWNLQLHNVQIKDKGVYQCFVHHRGAKGL
VPIYQMNSELSVLANFTQPEITLISNITRNSAINLTCSSVQGYPEPKKMFFVLKTENATT
EYDGVIEKSQDNVTGLYNISISGSITFSDDIRNATIYCVLQTESTETYSQHFPIVPADPV
PVEKPRLWIAAVALTLIVVCGIVLFLTLWKRKKEQQPGVCECETIKMDKAENEHVEERVK
IHEPEKIPAKAAKCEHRLKTPSSDKSAAHF
NT seq 993 nt   +upstreamnt  +downstreamnt
atggacgccggctgcacaatgggactgagtgtcacggtctttgtgatggccctcctgctc
tctggtgctgcttcccttaggatacaggcttatttcaacaagactgcagacctgccatgc
cagtttacaaactctcaaagcagaagcctaagtgagctggtagtattttggcaggaccag
gagaggttggttctgtacgagctcttcttaggcagagagaaacctgacaatgtggatcct
aagtacattggccgcacaagctttgaccaggaaagttggaacctacaacttcacaacgtt
cagatcaaggacaagggcgtgtatcaatgttttgtccatcacagaggggccaaagggctg
gttcccatctaccagatgaattctgagctgtcagtgcttgctaatttcactcaaccggaa
ataacattaatttccaatataacaagaaattctgccataaatttgacctgctcgtctgta
caaggctacccagaacctaagaagatgttctttgtgctaaaaactgagaatgcaaccact
gagtatgatggtgtcatcgagaaatctcaagataatgtcacaggactgtacaacatttcc
atcagcggatctatcacattctcagatgatataagaaacgcaaccatttactgtgtcctg
caaactgagtccacagagacatactcccagcatttccctatagtgcctgcggaccccgtg
ccagtggaaaaaccaaggctctggattgcagctgtggctctcaccctgatcgttgtgtgt
gggattgtgttgtttctaacactgtggaagaggaagaaggagcagcagcctggtgtctgt
gagtgtgaaaccatcaaaatggataaggcagagaatgagcatgtggaggaaagagtaaaa
atccatgaacctgaaaaaattccggcaaaggcagccaagtgtgaacatcgtttgaagacg
ccctcaagtgacaaaagtgctgcacatttttaa

KEGG   Oryctolagus cuniculus (rabbit): 100009377
Entry
100009377         CDS       T03373                                 

Symbol
CD80
Name
(RefSeq) CD80 molecule
  KO
K05412  CD80 antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04620  Toll-like receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05320  Autoimmune thyroid disease
ocu05322  Systemic lupus erythematosus
ocu05323  Rheumatoid arthritis
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100009377 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100009377 (CD80)
   04672 Intestinal immune network for IgA production
    100009377 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100009377 (CD80)
   05323 Rheumatoid arthritis
    100009377 (CD80)
   05320 Autoimmune thyroid disease
    100009377 (CD80)
   05330 Allograft rejection
    100009377 (CD80)
   05332 Graft-versus-host disease
    100009377 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100009377 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100009377 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100009377 (CD80)
CD molecules [BR:ocu04090]
 Proteins
  100009377 (CD80)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 I-set Ig_2 ig V-set_CD47
Other DBs
NCBI-GeneID: 100009377
NCBI-ProteinID: NP_001076132
Ensembl: ENSOCUG00000009504
UniProt: P42070
LinkDB
Position
14
AA seq 299 aa
MGHTLRPGTPLPRCLHLKLCLLLALAGLHFSSGISQVTKSVKEMAALSCDYNISIDELAR
MRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKN
ENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEE
LNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPID
QLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG
NT seq 900 nt   +upstreamnt  +downstreamnt
atgggccacacgctgaggccgggaactccactgcccaggtgtctacacctcaagctctgc
ctgctcttggcgctggcgggtctccacttctcttcaggtatcagccaggtcaccaagtcg
gtgaaagaaatggcagcactgtcctgtgattacaacatttctatcgatgaactggcgaga
atgcgcatatactggcagaaggaccaacagatggtgctgagcatcatctctgggcaagtg
gaagtgtggcctgagtacaagaaccgcaccttccccgacatcattaacaacctctccctt
atgatcctggcactgcgcctgtcggacaagggcacctacacctgcgtggttcagaagaat
gagaacgggtctttcagacgggagcacctgacctccgtgacactgtccatcagagctgac
ttccctgtccctagcataactgacattggacatcccgaccctaatgtgaaaaggataaga
tgctccgcctctggaggttttccagagcctcgcctcgcctggatggaagatggagaagaa
ctaaacgccgtcaacacgacggttgaccaggatttggacacggagctctacagcgtcagc
agtgaactggatttcaatgtgacaaataaccacagcatcgtgtgtctcatcaaatacggg
gagctgtcggtgtcacagatcttcccttggagcaaacccaagcaggagcctcccattgat
cagcttccattctgggtcattatcccagtaagtggtgctttggtgctcactgcggtagtt
ctctactgcctggcctgcagacatgttgcgaggtggaaaagaacaagaaggaatgaagag
acagtgggaactgaaaggctgtcccctatctacttaggctctgcgcaatcctcgggctga

DBGET integrated database retrieval system