KEGG   Oryctolagus cuniculus (rabbit): 100009013
Entry
100009013         CDS       T03373                                 
Symbol
EIF2AK2
Name
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04217  Necroptosis
ocu05010  Alzheimer disease
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100009013 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100009013 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100009013 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100009013 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    100009013 (EIF2AK2)
   05164 Influenza A
    100009013 (EIF2AK2)
   05162 Measles
    100009013 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    100009013 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009013 (EIF2AK2)
   05169 Epstein-Barr virus infection
    100009013 (EIF2AK2)
   05165 Human papillomavirus infection
    100009013 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009013 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009013 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009013 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009013 (EIF2AK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100009013 (EIF2AK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100009013 (EIF2AK2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100009013 (EIF2AK2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100009013 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm ABC1 Kinase-like Pkinase_fungal DND1_DSRM FTA2
Other DBs
NCBI-GeneID: 100009013
NCBI-ProteinID: NP_001075682
Ensembl: ENSOCUG00000007223
UniProt: Q287T5
LinkDB
Position
2:149149910..149190516
AA seq 547 aa
MANDLSPGFFIEELNKYRQKHSILLKYHELPQSGPPHDVTFTFKVIINEREFPEAEGKSK
KEAKNAAAKIAVDILNKENKEVSPLSLETTNTSEGSSIGNYIGLINRVAQKAKLTVNYEP
CELWEQGPKRFQYKCRIGLKVYGTGIGSTKQEAKQLAAKSAYHKILSEGTLMTINSTSPG
SVATTINDFRNIALVSHTCGSESPSENYFSTTVPEGSYNDDSLNNSSSSSMNVSRNNHKK
IKRHLAPTFNLPDKEASKYTVNPRFANDFKEIEPIGAGGFGQVFKAKHRIDGKTYVIKRV
KYDSEKVEREVKALAALTHPNIVHYYGCWVGHDYDPESSNSDTENSMNMNLGVKTRCLLI
QMEFCDLGTLDQWIETRSHQKSEKALALEFFWQITTGLKYIHSKELIHRDLKPNNIFLVA
INQIKIGDFGLVTSLQNNEKRTVNKGTLRYMSPEQISSQNYGKEVDIYALGLILAELLHI
CTTVVETAKIFAELRRGIFPDVFDIKEKTLLQKLLALEPEKRPDTSEILKTLAEWKNVSD
KKQRYTY
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggccaatgatctttcaccaggtttcttcatagaagaacttaacaaataccgtcagaaa
cacagcatactacttaagtatcatgaactgccccagtcggggcccccgcatgatgtgacg
tttacctttaaagttataataaatgaaagagaatttccagaagctgaaggtaaatcaaag
aaggaagcaaaaaatgctgcagccaaaatagctgttgatatacttaataaagaaaataag
gaagttagtcctttatcgctggaaacaacgaatacttcagaggggtcatccattgggaat
tacatcggccttatcaatagggttgctcagaaggcaaaactaactgtaaattatgaacca
tgtgaactgtgggagcaggggcccaaaagatttcagtataaatgccgaattgggctgaaa
gtatatggtaccggtattggttctactaaacaggaggcaaaacagttggctgctaaatct
gcatatcataagatactatcagaaggaaccttaatgacaattaactctacttctcctggt
tctgttgctactacaattaatgacttcagaaacatcgctttggtatcacacacatgtggt
tctgaatcgccatctgaaaattacttctcaacaactgtgccagaaggaagttataatgat
gacagtttaaacaattcttcgtcatcttctatgaatgtctccagaaataatcataagaag
ataaaaaggcatttggcgcctacatttaacctgcctgataaagaagcaagcaagtatact
gtgaaccccaggttcgccaacgattttaaagaaatagaaccaattggcgcaggtggattt
ggccaagttttcaaagcaaagcacagaattgatggaaagacttatgttatcaaacgtgtt
aaatatgatagtgagaaggtagagcgtgaagtcaaagcattagcagcactcactcatccc
aatattgttcactactacggttgttgggtcgggcatgattatgatcctgagagcagtaat
tcggataccgaaaacagcatgaatatgaatttaggagtgaagactaggtgccttttgata
caaatggaattctgtgacctagggacattggaccaatggattgaaaccagaagccaccag
aaatcagaaaaagctttggctttggagtttttttggcaaataacaacaggactgaaatat
atacattctaaagagttaattcatagagacctgaagccaaataacatatttttagtggct
ataaaccaaataaaaatcggagactttggacttgtaacatccctccaaaataatgaaaag
cgaacagttaataagggaactttacgatatatgagtccagaacagatttcttcccaaaac
tatgggaaggaagtggacatctatgctttggggctcattcttgctgaacttcttcacata
tgcaccacagttgtagaaacagcgaagattttcgccgagctaaggaggggcattttccca
gatgtgtttgacattaaagaaaaaactctgctacagaaattacttgcattggagcctgag
aaacgacctgacacgtctgaaatactgaagactttggctgagtggaagaatgtctcagac
aaaaagcaaagatacacgtattag

KEGG   Oryctolagus cuniculus (rabbit): 100009522
Entry
100009522         CDS       T03373                                 
Symbol
EIF2AK1
Name
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu05160  Hepatitis C
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100009522 (EIF2AK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100009522 (EIF2AK1)
   05162 Measles
    100009522 (EIF2AK1)
   05168 Herpes simplex virus 1 infection
    100009522 (EIF2AK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009522 (EIF2AK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100009522 (EIF2AK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100009522 (EIF2AK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100009522
NCBI-ProteinID: NP_001076215
Ensembl: ENSOCUG00000012606
UniProt: P33279
LinkDB
Position
Un
AA seq 626 aa
MLGGSAGTRGGEAEGDGAGAVGAVAPPPAIDFPAEVSDPKYDESDVPAELQVLKEPLQQP
AFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLR
LHHNRAITHLMRSARERVRQDPCADNSHIQKIRSREVALEAQTSRYLNEFEELSILGKGG
YGRVYKVRNKLDGQYYAIKKILIKGATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHV
HVHVQADRVPIQLPSLEVLSDQEEDRDQYGVKNDASSSSSIIFAEFSPEKEKSSDECAVE
SQNNKLVNYTTNLVVRDTGEFESSTERQENGSIVERQLLFGHNSDVEEDFTSAEESSEED
LSALRHTEVQYHLMLHIQMQLCELSLWDWIAERNRRSRECVDESACPYVMVSVATKIFQE
LVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQKNAARTSRNGERAP
THTSRVGTCLYASPEQLEGSEYDAKSDMYSVGVILLELFQPFGTEMERAEVLTGVRAGRI
PDSLSKRCPAQAKYVQLLTRRNASQRPSALQLLQSELFQNSAHVNLTLQMKIIEQEREIE
ELKKQLSLLSQARGVRSDRRDGELPA
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgctggggggcagcgccgggacccgcgggggcgaagccgagggcgacggggcgggggcg
gtgggggcggtggccccgccgcccgccatcgacttccccgctgaggtgtcggatcccaag
tatgacgagtcggatgtcccggcagagctgcaggtgctgaaggagccgctgcagcagcca
gccttccccttcgccgtcgccaaccagctgctgctcgtctccctgctggagcacctgagt
catgtgcacgagccaaacccgcttcgctccagacaggtgtttaaactgctctgtcagacc
ttcatcaaaatggggctgctgtcttccttcacctgcagcgacgagtttagctcattgagg
ctgcatcacaacagagctattacgcatctgatgaggtccgccagagagagagttcggcag
gatccctgtgctgataattctcatatccagaaaatcaggtcgcgagaagttgccttggaa
gcacagacctcacgatacttgaatgagtttgaagagctctccatcctggggaaaggtggc
tatggccgagtgtacaaggtcaggaataaattagatggccagtattatgcaattaaaaaa
attctgattaaaggtgcaactaaaacagattgcatgaaggtattacgagaagtgaaagtg
ctggcgggcctccagcaccctaatatcgtaggctatcacaccgcgtggatagagcatgtc
cacgttcacgttcaagcagacagagttccgattcagttgccttctctggaagtgctctct
gaccaggaagaagacagagatcaatatggtgttaaaaatgatgcaagcagcagctcatcc
attattttcgctgagttctccccagaaaaagaaaaatcctctgacgaatgtgccgttgag
agtcagaataacaaactggtgaactacaccaccaacttagtggtgagggacaccggtgag
tttgaatcgtccacggagcgccaagagaacggctcgatcgtggagcgtcagctactgttc
gggcataactcagacgtagaagaggatttcacgtccgcggaggaatcttctgaggaagac
ttaagcgcgttgcggcacacagaggtgcagtaccacctgatgctgcatatccagatgcag
ctgtgcgagctgtccctgtgggactggatcgccgagaggaacaggcggagccgagagtgc
gtggacgaatctgcctgtccttatgttatggtcagtgttgcaacaaaaatttttcaagaa
ctggtggaaggtgtgttttacatacataacatgggcatcgtgcacagagacctgaagcct
agaaatatttttcttcatggtcctgatcaacaagtgaaaataggagactttggtctggcc
tgcgccgacatcatccagaagaatgcggcccggaccagcagaaacggggagagagcaccc
acacacacttcccgagtgggcacctgtctgtacgcctcgcccgagcagttggaaggatcg
gagtatgatgccaagtcagacatgtacagcgtcggcgtgatcctgctggagctcttccag
cccttcgggacagagatggagcgggcagaggtcctgacgggcgtgcgagctggccgcata
cccgactccctcagtaagaggtgcccggcgcaggccaagtacgtccagctgctgaccagg
aggaacgcgtcccagcggccgtccgcccttcagctgctgcagagtgagctcttccagaac
tccgcgcatgttaacctcaccctacagatgaagataatagagcaggaaagagaaatcgag
gaactcaagaagcagctgagcctcctctcccaggcccgaggggtgaggagtgacaggcga
gacggagagctccctgcctag

KEGG   Oryctolagus cuniculus (rabbit): 100354847
Entry
100354847         CDS       T03373                                 
Symbol
EIF2AK3
Name
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05160  Hepatitis C
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100354847 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100354847 (EIF2AK3)
   04137 Mitophagy - animal
    100354847 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    100354847 (EIF2AK3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100354847 (EIF2AK3)
   05162 Measles
    100354847 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    100354847 (EIF2AK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100354847 (EIF2AK3)
   05012 Parkinson disease
    100354847 (EIF2AK3)
   05014 Amyotrophic lateral sclerosis
    100354847 (EIF2AK3)
   05020 Prion disease
    100354847 (EIF2AK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100354847 (EIF2AK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100354847 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100354847 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100354847 (EIF2AK3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100354847 (EIF2AK3)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100354847 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Kinase-like Kdo ABC1 APH
Other DBs
NCBI-GeneID: 100354847
NCBI-ProteinID: XP_017195719
Ensembl: ENSOCUG00000012451
LinkDB
Position
2:99040177..99118159
AA seq 1219 aa
MLTTGESLFSPKGPARGPRIGRSRSQSEGRSAESLLNGRCQREAVTQVVVAEAELRRGRG
DAAGCPGRRGGSADPSALSPRSQAPRGGRRRLRLHARARGGPLMERATRPGSLVRALLLP
LLLALTAGTRAAARARDLPAPRAEAAFGLGAAAAPTSAARVPAAGAVAAAEVTVEDAEAL
PRSCGRARSRGDLEPEDEAELRSPGRSLVIISTLDGRIAALDPENHGKKQWDLDVGSGAL
VSSSLSKPEVFGNKVIIPSLDGDLFQWDRDRESMETVPFTVESLLESSYKFGDDVVLVGG
KSLSTYGLGAYSGKVRYICSALGCRRWDSDEMEEEEDILLLQRTQKTVRAVGPRSGNEKW
NFSVGHFELRYIPDMETRAGFIESTFKPRGNKEESKIISDVEEQEAATMDAVIKVSVADW
KVMAFSKKGGHLEWEYQFCTPIASAWLVKDGKVIPISLFDDTSYTSNEDALEEEEDIVEA
ARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNNENAIIPLPTIKWKPLIHS
PSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYYLPYYKRERNKRSTQIT
VRFLDNPSYSKNIRRKDPVLLLHWWKEILGTIVFCIVATTFIVRRLFHPHPHRQRKESET
QCQTENKYDAVSGETNDSTWSDLKSSGYVSRYLTDFEPIQCLGRGGFGVVFEARNKVDDC
NYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKD
ESTDWPLSSPSPMDAPSVKIHRVDPFSTKERIEIIAPSPQRSRSFSVGISCGQTSSSESR
FSPLDFSGTEHGDVSGSVDAASNLRDSCLTDCEGEDGTMDGNDEGHCFELCPAEASPSVR
SRERTSSSIVFEDSGCDNASSKEEPRALRLPLGNHCADKLTPFQPSSSSSSSEATLSVSP
PRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKETLKDWMSRRCTIEERERGACLHI
FLQITEAVEFLHSKGLMHRDLKPSNIFFAMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPA
YATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFNTQMERVRTLADVRNL
KFPPLFTQKCPREYVMVQDMLSPSPMERPEATNIIENAIFEELEFPGKTVLRQRSRSASS
SGTKHSRQPSNSQSPVPGN
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgttgacaaccggggaaagcctgttttctccgaaaggaccagctcgggggccccggatt
ggcaggagccgcagccaatcggagggcagaagcgcggaaagtttgctcaatgggcgatgt
cagagggaggctgtcactcaggtggtggtggcagaggctgagctgagacgtggccgggga
gacgcggctggctgtccaggccgtcggggcggcagtgcggaccccagcgcgctctcgccc
agatcgcaggctccgagaggcgggcgccggcggctgcgcctccatgcccgcgcgcggggc
gggccgctgatggagcgcgccacccgcccggggtcgctggtgcgggcgctgctgctgccg
ctgctgctggccctgacggcggggacccgggccgcggcgcgcgcccgcgacctccccgcg
ccgagggcggaggcggcgttcggcctgggggccgcggccgcccccacgtcggccgcgcga
gtgccggcggccggggccgtggcggcggcggaggtgacggtggaggacgccgaggcgctc
ccccgcagctgcgggcgagcccggagtcgcggggacctggaacccgaggacgaggccgag
ctgcggtcgcccggcagatcattagtaattatcagcactttagatggaagaattgctgcc
ttggatcctgagaatcatggcaaaaagcaatgggatttagatgtgggatctggtgccttg
gtttcatccagcctcagcaaaccagaggtgtttgggaataaggtcatcattccttccctg
gatggagacctcttccagtgggaccgagaccgtgagagcatggaaactgttcctttcaca
gttgaatcccttcttgaatcttcttataaatttggagatgatgtggttttggtgggagga
aagtccctcagtacatacgggctcggcgcatacagtggaaaggtgaggtacatctgttca
gctctgggctgtcgccggtgggacagtgacgagatggaagaggaggaggacatcctgctt
ttgcagcgcacccagaagaccgttagagctgtcgggccccgcagcggcaatgagaagtgg
aatttcagtgttggccactttgaacttcggtatattccagacatggaaactagagccgga
tttattgaaagcacctttaagcccagagggaacaaagaagagtctaaaattatttcagat
gtggaagaacaggaagctgccacgatggacgcggtgataaaggtctcggtggccgactgg
aaggtcatggcgttcagcaagaagggagggcacctggagtgggagtaccagttttgcact
ccaattgcatctgcctggttggttaaggacgggaaagtcattcccatcagtctctttgat
gacacaagttacacgtcgaatgaggacgctctggaagaggaggaagacattgtggaagct
gcccgcggagccacagagaacagcgtgtacttgggaatgtatagaggccagctatattta
cagtcatcagtcagaatttcagagaagtttcctacaagtcccaaagccttggaatctgtc
aataatgaaaatgcaattattcctttgccaacaatcaagtggaagcctttaattcattct
ccttctagaacacccgtcttggtaggatctgatgaatttgacaaatgtcttagtaatgat
aagttttctcatgaagagtacagcaatggtgccctttcaattttgcagtatccatatgat
aatggctactatctgccgtattacaagagggaaaggaacaaacggagcacccagatcaca
gtcaggttcctggacaaccccagctacagcaagaacatccgcagaaaggaccccgtcctc
ctcttacactggtggaaggaaatcctggggacgattgtgttttgtatcgtagcaacaacc
tttattgtgcgccgacttttccatcctcatcctcacagacaaaggaaggaatccgaaact
cagtgtcagacagaaaataaatatgatgctgtaagtggtgaaaccaatgacagcacctgg
agtgacctgaaaagctctggatatgtgtcgcgatatctgacagattttgaaccaattcag
tgcctgggtcgtggaggctttggagttgtctttgaagccagaaacaaagtcgacgactgc
aactatgccatcaagaggatccgtcttcccaacagggagctggctcgggaaaaggtgatg
cgggaagtgaaggccctcgccaagctcgagcacccgggcatagttaggtatttcaatgcc
tggctggaggcgccgccggagaagtggcaagaaaagatggatgaaatctggctgaaagat
gaaagcacagactggccactcagctctcccagcccgatggacgcaccatcagttaagata
cacagagtggatcctttctctacaaaagaacgcattgaaatcatagctccttcaccgcaa
agaagcaggtctttctcggtggggatttcctgtggccagacgagttcgtccgagagccgg
ttttctccactggatttctcggggacggagcacggggacgtcagtgggtctgtggatgca
gcctccaacctccgggacagttgcctcacagactgcgagggggaagacgggaccatggac
ggcaatgacgagggacactgctttgaactgtgtcctgcggaagcctctccttccgtcagg
tcaagggagagaacctcctcttcgatagtgtttgaagattctggctgtgataatgcatcc
agcaaagaagagcccagagctctccggctgccactcggcaaccactgtgctgataaactg
acccctttccagccctccagcagcagctcctcctcggaagctaccctgtctgtttctcct
ccgagaccgaccacgctgagtctggatctcacgaagaacactacggagaagctccagccc
agctccccaaaggtgtacctgtacatccagatgcagctgtgccggaaggagaccctcaag
gactggatgagccggcgctgcaccatagaggagagggagcgcggcgcgtgtctgcacatc
ttcctgcagatcaccgaggccgtggagttcctgcacagcaaaggactcatgcacagggac
ctcaagccttccaacatattctttgcaatggatgacgtggtcaaggttggagactttgga
ttagtgacggcaatggaccaagacgaggaagagcagacggttctgaccccaatgccagct
tacgccacacacacgggacaagtagggaccaaactctatatgagcccggagcagattcac
ggaaacaactactctcataaagtggacatcttttcgttaggcctgatcctgtttgagttg
ctgtaccccttcaacacgcagatggagagagtcagaaccttagctgacgtacgaaatctc
aaatttccaccgctgtttactcagaagtgtcctcgtgagtacgtgatggtccaagacatg
ctctccccatcccccatggaacggcccgaagcaacaaacatcattgaaaatgccatattt
gaggagttggagttcccagggaaaaccgtgctcagacagaggtcgcgctccgcgagttca
tcaggaacaaaacattcaagacagcccagcaactcacagagccctgtgccgggcaactag

KEGG   Oryctolagus cuniculus (rabbit): 100358284
Entry
100358284         CDS       T03373                                 
Symbol
EIF2AK4
Name
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 4
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu05160  Hepatitis C
ocu05162  Measles
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100358284 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100358284 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100358284 (EIF2AK4)
   05162 Measles
    100358284 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    100358284 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100358284 (EIF2AK4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100358284 (EIF2AK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100358284 (EIF2AK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like ABC1 APH
Other DBs
NCBI-GeneID: 100358284
NCBI-ProteinID: XP_002718031
Ensembl: ENSOCUG00000006506
UniProt: G1SR58
LinkDB
Position
17:complement(32034863..32160867)
AA seq 1651 aa
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACRPVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEEEQREILHEIQ
RRKEEIKEEKKRKEIAKQERLEIASLSNQNHTSRKDPGGHRTAALLHGGSPDFVGNGKHR
ANSSGRSRRERQYSVCSGEDSPGSCEILYFCLGGPDQLMVHKGKCVGSDEQLGKLVYNAL
ETATGSFVLLYEWVLQWQKKMGPFLTSQEREKIDKCKKQIQGAETEFNSLVKLSHPNIVR
YFAMNLKEQDDSIVVDILVEHISGVSLATHLSRSGPVPVHQLRRYAAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGAVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPGDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFVN
PQPKTPLVEQSPEDSGGQDYVETVIPSNQLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGTGTPPQDSGPLARDGRAARAQAAGDTGDTDGPDSVEANAPPPITSSVEWSTSGERS
ASARFPAAGPGSSSDDEDDEDEHDGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCR
EENGGCESELSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTIRLWRLFREILDGLAY
IHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADGKQEDQADSLIKSDPSGRL
TGMVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPA
SPKFPEDFDDGEHTKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHT
LANVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRAAKIQQHVCETIIRIFKRH
GAVQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYC
IERVFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAEIIYTIYEIIQEFPALQERNYSI
YLNHTMLLKAILLHCGIPEDKLSQVYVILCDAVTEKLTRREVEAKFCNLSLSSNSLCRLY
KFIEQKGDLQDLMPTINSLIKQKTGVSQLVKYGLKELEEVVGLLKKLGVKLQVFINLGLV
YKVQQHNGIIFQFVAFIRRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGASIAI
DKISTAVLNMEEPATVSSCDLLVVSVGQMSMSRAIHLTQKLWTAGITAEIMYDWSQSQEE
LQEYCRHHEITCVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVVHKLRTKVSDER
NIREVSDNLAVQNLKGSFSNASGLFEIHGATVIPIVSVMAPEKLSASTRRRYETQVQTRL
QTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKL
VCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4956 nt   +upstreamnt  +downstreamnt
atggctgggggccgtggggcccccgggcgcggccgggacgagccgcccgagagctatcca
cagcgacaggaccacgaactgcaggccctggaggccatctacggcgccgacttccaagac
ctgcggccggacgcgtgcagaccggtcaaagaaccccctgaaatcaatttagtgttgtac
cctcagggcctaactggtgaagaagtatatgtgaaagtggatttaagggttaaatgccca
ccaacctatccagatgtagttcctgaaatagagttaaagaatgccaaaggtctttcaaat
gaaagtgttaatttgctaaaatcccgcctggaagaactggcaaaaaaacactgtggtgag
gtgatgatatttgaactggcctaccatgtgcagtcatttctgagcgagcataacaagccc
ccacccaagtctttccatgaagaaatgctggagaggcgggcacaggaggagcaacagagg
ctgctggaggctaagcggaaggaggaggaggagcaacgtgaaatccttcatgagattcag
agaaggaaagaagagataaaagaagagaaaaaaaggaaggaaatagctaagcaggaacgc
ttggaaattgctagtttgtcaaaccaaaatcacacctccaggaaagacccaggaggacac
agaacagctgcccttctacatggaggttctccagactttgtagggaatggtaaacatcgg
gccaactcctcagggaggtccaggcgagaacgtcagtactctgtatgtagtggtgaagat
tcgcctggctcttgtgaaatcctgtatttctgcctgggtggtcctgatcagctcatggtg
cacaaagggaaatgtgttggcagtgatgagcagcttggaaaattagtgtacaatgctctg
gaaacagccaccggcagctttgtcttgctatatgagtgggtccttcagtggcagaaaaaa
atgggtccgtttcttaccagtcaagaaagagagaagattgataagtgcaaaaagcagatt
caaggggcagaaacagaattcaactcactggtgaaactgagccatccaaacatagttcgc
tactttgcaatgaacctcaaagagcaagatgactccattgtggtagacattttagtggaa
cacattagcggtgtctctctcgccacacacctgagtcgctcaggccccgtccctgtgcat
caactgcggaggtacgcagctcagctcctgtccggtctcgattatcttcacagcaattcc
gtggttcacaaggtcctgagtgcatctaatgtcttggtggatgcagagggcgccgtcaag
attacggactacagcatttctaagcgccttgcagacatttgcaaggaggatgtgtttgag
caaacgcgagttcgttttagtgacaatgcgctgccttataaaaccgggaagaaaggggat
gtttggcgtctgggccttctgctgctctccctcagccaaggacaggagtgtggggagtac
cctgtgaccatccctggtgacttgccagctgactttcaagatttcctgaagaagtgcgtt
tgcttagatgacaaggagaggtggagccctcagcagctgttgaaacacagctttgtaaat
cctcagccaaagacgccgttagtggaacagagtcctgaagattctgggggccaggattac
gttgagactgtcattcccagcaaccagctacccagcgcggcattcttcagtgagacccag
agacagttttcccggtatttcattgaatttgaagaattgcagcttcttggcaaaggggct
ttcggagctgtcatcaaggtgcagaataagctggatggctgctgctacgcggtgaagcgc
atccccattaatcccgccagcaggcacttccgcaggatcaagggtgaagtgacgctgctg
tcgcgcctgcaccatgagaatatcgtgcgctattacaacgcctggatcgagcggcacgag
cggccggcggggaccgggacaccgccccaggactcggggcccctggcccgggacgggcga
gccgcacgcgcgcaggcggcgggcgacactggcgacactgacggcccggacagtgtggag
gccaacgccccgccgcccatcaccagctcggtggagtggagcacatcgggcgagcgctca
gccagcgcccgcttcccggctgcgggcccgggctccagcagcgacgatgaagacgacgag
gacgaacacgacggtgtcttctctcagtccttcctaccagcttcagattctgaaagtgat
atcatctttgataatgaagatgagaacagtaagagtcagaatcaggatgaagactgcaga
gaggagaatggtggctgtgaaagtgagctgtcagtgacgactgaggctgtgcactacctg
tatatccagatggagtattgcgaaaagagcactttacgtgacaccatcgaccagggacta
taccgagacaccatcagactctggaggcttttccgagagattctcgatggactggcttat
atccatgagaaaggaatgattcaccgggatttgaagcctgtcaacatttttttggattct
gatgaccatgtgaaaataggtgattttggtttggcgacagaccacctagcattttctgct
gacggcaaacaggaggatcaggcagactccttgattaaatcagacccttcaggccgcttg
accgggatggttggcactgctctatatgtaagcccagaggtccaggggagcaccaagtct
gcatacaaccagaaagtggatctcttcagcctgggaattatcttctttgagatgtcctat
caccccatggtcacagcctcagaaaggatctttgtcctcaaccaactcagagatcccgct
tcgcctaagtttccagaagacttcgatgatggagaacatacaaagcagaaatctgtcatc
tcctggctgctgaaccacgatccggccaagcggcccacggccacagaactgctcaagagc
gagctgctgcccccgccccagatggaggagtcggagctgcatgaggtgctgcaccacacg
ctggccaacgtggatgggaaggcctatcgcaccatgatggcccagatcttctcccagcgc
atctcccccgccatcgactacacctacgacagcgacatcctcaagggcaacttctcaatc
cgtgcggccaagatccagcaacatgtgtgtgaaaccatcatccgcatctttaaacgacac
ggagctgtccagttgtgtaccccactgctgcttccccgaaacaggcaaatatatgagcac
aatgaagctgccttattcatggaccacagcgggatgctggtgatgctgcccttcgaccta
cgggtcccttttgcaagatatgtggcaagaaataacatactgaatttgaaacgatactgc
atagaacgcgtattcagacctcgcaagttagatcgatttcatcccaaagaacttctggaa
tgtgcatttgacatcgtcacttctaccaccaacagctccctgcccactgctgaaatcatc
tacaccatctatgaaatcatccaggagttcccggcccttcaggaaagaaactacagtatt
tatttgaatcataccatgttattgaaagcaatactattacactgtgggatcccagaagat
aaactcagtcaagtctatgttattctgtgtgatgccgtgacagagaagctgacgaggaga
gaagtggaagctaaattttgtaatctgtctttgtcttctaacagtctgtgtcgactctac
aagtttattgagcagaagggagacttgcaagacctaatgccgacaatcaactcattaata
aaacagaagacaggtgtctcccagttggtgaaatacggcttgaaagagctggaagaggtc
gtcgggctgctgaagaaacttggcgtgaagttacaggtcttcatcaacctgggcctggtt
tacaaggtgcagcagcacaacgggatcatcttccaatttgtggcattcatcagacgaaga
cagagggctgtacccgaaatccttgctgctggcggcagatacgacctgctgatcccccag
tttagaggaccacaagctctggggccagtgcccactgccatcggggccagcatagctatt
gacaagatatccactgctgtcctcaacatggaggagcctgctaccgtaagctcttgtgac
ctcctggttgtcagtgttggccagatgtccatgtccagggccatccacctaactcagaaa
ctctggacagcaggaatcacagcagaaatcatgtacgactggtcacagtcccaggaggaa
ttacaggagtactgcagacatcatgaaatcacctgtgtggcccttgtctcggataaagaa
ggcagccacgtcaaggttaagtcttttgagaaggaaaggcaaacagagaagcgcgtgctg
gaatctgatcttgtggaccatgttgtgcacaaactgaggactaaagtcagtgatgaaagg
aatatcagagaagtttccgataatcttgcagtgcaaaatctgaaggggtcattttctaat
gcttcaggtttgtttgaaatccatggagcaacagttattcccattgtgagcgtgatggcc
ccggagaagctgtcggccagcaccaggaggcggtatgagactcaggtgcaaacccgactt
cagacctcccttgccaatttacatcagaagagcagtgaaatcgagattctggccgtggat
ctacccaaagaaacgattttacagtttttatcattagagtgggatgctgatgaacaggca
tttaacacaactgtgaagcagctgctatcacgcctaccgaagcaaagataccttaaattg
gtttgtgatgaaatttataacatcaaagtagagaaaaaggtgtctgtgctatttctgtat
agctatagagatgactactacagaatcttattttaa

DBGET integrated database retrieval system