KEGG   Oryctolagus cuniculus (rabbit): 100009017
Entry
100009017         CDS       T03373                                 
Symbol
IL15
Name
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04668  TNF signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100009017 (IL15)
   04668 TNF signaling pathway
    100009017 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009017 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100009017 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009017 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009017 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009017 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009017 (IL15)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100009017 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 100009017
NCBI-ProteinID: NP_001075685
Ensembl: ENSOCUG00000008827
UniProt: Q3Y5G8
LinkDB
Position
15:complement(22773802..22866051)
AA seq 162 aa
MRISKPYLRSTSIQCYLCLLLNSHFLAEAGIHVFIFGCISAGLPKTEANWHDVISDLKRI
EDLIKSIHIDATLYTESDAHPNCKVTAMKCFLLELRVISHESRNMDINETVQNLIILANT
SLSSKGNVTESGCKECEELEEKNITEFLQSFIHIVQMFINSP
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccgtatctgagaagtacttccatccagtgctacctgtgtttactc
ctaaacagtcattttttagctgaggctggcattcatgtcttcatttttggctgtatcagt
gcaggtcttcctaaaacagaagccaactggcatgatgtcattagtgatctgaaaagaatt
gaagatcttataaaatccatccatattgatgctactttatatactgagagtgatgctcat
cccaattgcaaagtcacagcgatgaagtgctttctcctggagttacgagttatttctcat
gagtccagaaacatggacattaatgaaacagtacaaaaccttatcatcctagcaaatacc
agtttatcttctaaagggaatgtaacggaatctggttgcaaagaatgtgaggaactggag
gaaaaaaatattactgaatttttgcagagttttatacatattgtacaaatgttcatcaat
tctccttga

DBGET integrated database retrieval system