KEGG   Oryctolagus cuniculus (rabbit): 100009139
Entry
100009139         CDS       T03373                                 
Symbol
PPP2R2B
Name
(RefSeq) protein phosphatase 2 regulatory subunit Bbeta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100009139 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100009139 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    100009139 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    100009139 (PPP2R2B)
   04152 AMPK signaling pathway
    100009139 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100009139 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009139 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100009139 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100009139 (PPP2R2B)
   05165 Human papillomavirus infection
    100009139 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100009139 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009139 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009139 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009139 (PPP2R2B)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100009139 (PPP2R2B)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100009139 (PPP2R2B)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100009139 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 100009139
NCBI-ProteinID: NP_001182647
Ensembl: ENSOCUG00000006861
UniProt: A0A5F9C5L3
LinkDB
Position
3:complement(28594778..28886976)
AA seq 443 aa
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaggaggacattgatacccgcaaaatcaacaacagtttcctgcgcgaccacagctat
gcgaccgaagctgacattatctctacggtagaattcaaccacacgggagaattactagcg
acaggggacaaggggggtcgggttgtaatatttcaacgagagcaggagagtaaaaaccag
gttcaccgcaggggtgaatacaatgtttacagcacattccagagccatgaacccgagttc
gattacctgaagagtttagaaatagaagaaaaaatcaataaaataagatggctcccccaa
cagaatgcagcttactttcttctgtctactaatgataaaactgtgaagctatggaaagtc
agcgagcgtgataagaggccagaaggctacaatctgaaggatgaggagggccggctccgg
gaccctgccaccatcacaaccctgcgggtgcctgtgctgagacccatggacttgatggtg
gaggccaccccacgaagagtatttgccaacgcacacacgtatcacatcaactccatatca
gtcaacagtgactatgaaacctacatgtctgctgatgacctaaggattaacctatggaac
tttgaaataaccaatcaaagttttaacatcgtggacatcaagccggccaacatggaggag
ctcacggaggtgatcacggcggccgagttccacccccaccactgcaacacgttcgtgtac
agcagcagcaaagggacaatccggctgtgtgacatgcgggcgtcggccctgtgtgacagg
cacaccaagttttttgaagagccggaagatccaagcaacagatcgtttttctctgaaatt
atctcttcgatttcggatgtcaagtttagccacagtgggaggtatatcatgaccagggac
tatctcaccgttaaagtctgggatctcaacatggaaaatcgccccattgagacctaccag
gtgcatgactacctccgcagcaagctgtgctccctctacgaaaacgactgcatttttgat
aaatttgaatgtgtgtggaacggttcagacagtgtcatcatgacgggctcctacaacaac
ttcttcaggatgttcgaccgcaacaccaagcgtgacgtgaccctggaggcctcgagggaa
aacagcaaaccccgggccatcctcaaaccccgcaaagtgtgtgtgggaggcaagcggaga
aaagacgagatcagcgtcgacagtctggactttagcaaaaagatcttgcatacagcttgg
catccctcagaaaacatcatagcagtggcggctaccaataacctatacatattccaggac
aaggttaactag

KEGG   Oryctolagus cuniculus (rabbit): 100009252
Entry
100009252         CDS       T03373                                 
Symbol
PPP2CA
Name
(RefSeq) protein phosphatase 2 catalytic subunit alpha
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04136  Autophagy - other
ocu04140  Autophagy - animal
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100009252 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100009252 (PPP2CA)
   04390 Hippo signaling pathway
    100009252 (PPP2CA)
   04071 Sphingolipid signaling pathway
    100009252 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    100009252 (PPP2CA)
   04152 AMPK signaling pathway
    100009252 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100009252 (PPP2CA)
   04136 Autophagy - other
    100009252 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009252 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100009252 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009252 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    100009252 (PPP2CA)
   04730 Long-term depression
    100009252 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100009252 (PPP2CA)
   05165 Human papillomavirus infection
    100009252 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100009252 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009252 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009252 (PPP2CA)
   04131 Membrane trafficking [BR:ocu04131]
    100009252 (PPP2CA)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009252 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009252 (PPP2CA)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100009252 (PPP2CA)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100009252 (PPP2CA)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100009252 (PPP2CA)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100009252 (PPP2CA)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100009252 (PPP2CA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100009252 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 100009252
NCBI-ProteinID: NP_001095156
Ensembl: ENSOCUG00000015961
UniProt: P67777
LinkDB
Position
3:complement(17013124..17061865), 16:70308010..70308771
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagttactgtctgtggagatgtgcatggg
caatttcacgatctcatggaactgtttagaattggtggcaaatcaccagacacaaattac
ttgtttatgggagattatgttgacagaggatattactccgttgaaacagttacactgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgaggaaatcatgagagc
agacagatcacacaggtttatggtttctatgatgaatgtttaagaaaatatggaaacgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctgcacgggggcctctcaccatctatagatacactggatcacatc
agagcacttgaccgcttacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatttctcctcgaggagctggttacaccttt
gggcaagatatttctgagacattcaatcatgccaatggcctgacgttggtgtctagagct
caccagctggtgatggagggatataactggtgccatgaccgaaatgtagtaacaattttc
agtgctccaaactattgttaccgctgtggtaaccaagctgcaatcatggaacttgatgac
actctaaaatactctttcttgcagtttgacccagctcctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100009300
Entry
100009300         CDS       T03373                                 
Symbol
PPP2CB
Name
(RefSeq) protein phosphatase 2 catalytic subunit beta
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04136  Autophagy - other
ocu04140  Autophagy - animal
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100009300 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100009300 (PPP2CB)
   04390 Hippo signaling pathway
    100009300 (PPP2CB)
   04071 Sphingolipid signaling pathway
    100009300 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    100009300 (PPP2CB)
   04152 AMPK signaling pathway
    100009300 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100009300 (PPP2CB)
   04136 Autophagy - other
    100009300 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009300 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100009300 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009300 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100009300 (PPP2CB)
   04730 Long-term depression
    100009300 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100009300 (PPP2CB)
   05165 Human papillomavirus infection
    100009300 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100009300 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009300 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100009300 (PPP2CB)
   04131 Membrane trafficking [BR:ocu04131]
    100009300 (PPP2CB)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009300 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009300 (PPP2CB)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100009300 (PPP2CB)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100009300 (PPP2CB)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100009300 (PPP2CB)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100009300 (PPP2CB)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100009300 (PPP2CB)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100009300 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 100009300
NCBI-ProteinID: NP_001095177
Ensembl: ENSOCUG00000005230
UniProt: P11611
LinkDB
Position
2:76926974..76957892
AA seq 309 aa
MDDKTFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaagacgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aagcagctcaacgagaaccaagtgcggacgctgtgcgagaaggctaaggaaattttaaca
aaagaatccaatgtgcaagaggttcgttgtcctgttaccgtctgtggagatgtgcatggt
caattccatgaccttatggaactctttagaattggtgggaaatcaccagatacaaactat
ctattcatgggagactacgtggacagaggttattactcagtggagactgtgactcttctt
gtagcattaaaggtgcgttatccagaacgcattacaatattgagaggaaatcatgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctacggaagtatggaaatgcc
aatgtgtggaaatattttacagacctatttgattatcttccacttacagctttggtagat
ggacagatattctgcctccatggtggcctgtctccatccatagatacactggatcatata
agagccctggatcgtttacaagaagttccacacgagggcccaatgtgtgatctgttgtgg
tctgatccagatgatcgtggtgggtggggtatttcaccacgtggtgccggctacactttt
ggacaagacatttctgaaacatttaaccacgccaatggtctcacactggtctcccgtgcc
caccagcttgtgatggagggatacaactggtgtcatgaccggaatgtggttaccattttc
agtgcacctaattactgttaccgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcagttcgatccagcacctcgtcgtggagagcctcacgta
acccggcgcaccccagactacttcctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100328616
Entry
100328616         CDS       T03373                                 
Symbol
PPP2R2A
Name
(RefSeq) protein phosphatase 2 regulatory subunit Balpha
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100328616 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100328616 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    100328616 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    100328616 (PPP2R2A)
   04152 AMPK signaling pathway
    100328616 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100328616 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100328616 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100328616 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100328616 (PPP2R2A)
   05165 Human papillomavirus infection
    100328616 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100328616 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100328616 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100328616 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100328616 (PPP2R2A)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100328616 (PPP2R2A)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100328616 (PPP2R2A)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100328616 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 100328616
NCBI-ProteinID: NP_001164546
Ensembl: ENSOCUG00000027088
UniProt: P63150
LinkDB
Position
2:complement(43338816..43423754)
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcaatggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttctacggtagaatttaatcattctgga
gagttactagcaacaggagataaaggtggtagagtcgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatacaatgtttacagcaccttccagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttctattgtctaccaatgataaaacaataaaa
ttatggaaaattagtgaaagggacaaaagaccagaagggtataacttgaaagaggaagat
ggaagatatagagatcctactacggttactacactacgagtgccagtctttaggcccatg
gatctaatggtcgaggccagtccacgaagaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacttatttatctgcagatgatttgcggatt
aatctttggcatctggaaattacagacaggagttttaatattgtggatatcaaacctgcc
aatatggaagaactaacggaagtaattacagcagcagaattccatccaaatagctgtaac
acgtttgtatacagcagcagtaaaggaactattcggttatgtgacatgagggcatctgcc
ctctgtgataggcattctaaattgtttgaagaaccagaagaccccagtaacaggtcattt
ttttccgaaatcatctcctctatatctgatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgagtacctcagaagtaagctttgttcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgactgga
tcttataataatttcttcagaatgtttgacaggaacacaaaacgagacataaccctagaa
gcatcacgggaaaacaataagcctcgcacagtgttgaagccacggaaagtctgtgcgagt
ggcaagcgaaagaaagatgaaataagcgttgacagcctagacttcaacaagaaaatcctt
catacagcctggcaccccaaggaaaatatcattgctgtagctaccacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Oryctolagus cuniculus (rabbit): 100328617
Entry
100328617         CDS       T03373                                 
Symbol
PPP2R2C
Name
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100328617 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100328617 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    100328617 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    100328617 (PPP2R2C)
   04152 AMPK signaling pathway
    100328617 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100328617 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100328617 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    100328617 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100328617 (PPP2R2C)
   05165 Human papillomavirus infection
    100328617 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100328617 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100328617 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100328617 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100328617 (PPP2R2C)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100328617 (PPP2R2C)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100328617 (PPP2R2C)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100328617 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 100328617
NCBI-ProteinID: NP_001164547
UniProt: P50410
LinkDB
Position
Un
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAVTDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDVH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgaccgaagccgatatcatctccacggtcgagttcaaccacaccggggagctgctggcc
acgggcgacaagggcggccgggtcgtcatcttccagcgggagccagagagtaagaatgcg
ccccacagccagggcgagtacgacgtctacagcaccttccagagccacgagcccgagttc
gactatctcaagagcctggagatagaggagaagatcaacaagatcaagtggctgccgcag
cagaacgctgcccactcgctcctgtccaccaacgacaaaaccatcaagctatggaagatc
accgagcgagacaagaggcccgagggctacaacctgaaggacgaagaagggaagctcaag
gacctgtccacggtgacgtcactgcaggtgcccgtgctgaagcccatggacctgatggtg
gaggtgagcccacggaggatctttgccaacggccacacctaccacatcaactccatctcc
gtgaacagcgactgcgagacgtacatgtcggccgatgacctgcgcatcaacctctggcac
ctggccgtcaccgacaggagcttcaacatcgtggacatcaagccggccaacatggaggac
ctcaccgaggtgatcacggcgtccgagttccacccgcaccactgcaacctgtttgtgtac
agcagcagcaagggctccctgcggctctgcgacatgcgggcggccgccctgtgcgacaag
cactccaagctctttgaggagcccgaggaccccagtaaccgctccttcttctcagaaatc
atctcatctgtgtcagacgtgaagttcagccacagcggccggtacatgctcacgcgggac
tacctcacggtcaaggtgtgggacctgaacatggaggcgaggcccattgagacctaccag
gtccacgattacctgcggagcaagctgtgctccctgtatgagaacgactgcattttcgac
aagtttgagtgtgcctggaacgggagtgacagtgtcatcatgaccggggcttacaacaac
ttcttccgcatgttcgaccgcaacaccaagcgagacgtgaccctggaggcctcgcgggag
agcagcaagcccagggccgtgctgaagccgcggcgcgtgtgcgtgggcggcaagcggcgg
cgggacgacatcagcgtggacagcctggacttcaccaagaagatcctgcacacggcctgg
cacccggccgagaacatcatcgccatcgccgccaccaacaacctgtacatcttccaggac
aaagtcaactccgacgtgcactag

KEGG   Oryctolagus cuniculus (rabbit): 100348286
Entry
100348286         CDS       T03373                                 
Name
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100348286
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100348286
   04071 Sphingolipid signaling pathway
    100348286
   04151 PI3K-Akt signaling pathway
    100348286
   04152 AMPK signaling pathway
    100348286
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100348286
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100348286
  09156 Nervous system
   04728 Dopaminergic synapse
    100348286
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100348286
   05165 Human papillomavirus infection
    100348286
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100348286
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100348286
   03036 Chromosome and associated proteins [BR:ocu03036]
    100348286
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100348286
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100348286
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100348286
SSDB
Other DBs
NCBI-GeneID: 100348286
NCBI-ProteinID: XP_017195371
LinkDB
Position
Un
AA seq 288 aa
MDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKP
ANMEELTEVITAAEFHPHQCNVLVYSSSKGTVRLCDMRSSALCDRHAKFFEEPEDPSSRS
FFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYEN
DCIFDKFECCWNGSDSAIMTGSYNNFFRMFDRSSRRDVTLEASRENSKPRASLKPRKVCA
GGKRKKDEISVDSLDFNKKILHTAWHPVENTIAVAATNNLYIFQDKAN
NT seq 867 nt   +upstreamnt  +downstreamnt
atggaccttatggtggaagccagcccgcggcggatctttgcgaatgctcacacgtatcac
atcaattccatttcagtgaacagtgaccacgagacgtatctctctgcagatgacctgcga
attaacctgtggcacctggaaatcacggacagaagtttcaacatcgtggacatcaagccc
gcgaacatggaggagctgacggaggtcatcacggcggccgagttccacccgcaccagtgc
aacgtgctcgtctacagcagcagcaagggcaccgtgcggctgtgcgacatgcgctcgtcc
gccctgtgcgacaggcacgccaaattctttgaggagccggaggatcccagcagcaggtcc
ttcttctcagagatcatctcctccatctccgacgtcaagttcagccacagcgggcggtac
atgatgaccagggactacctgtcggtgaaggtgtgggacctcaacatggagagcaggccc
gtggagacgcaccaggtgcacgagtacctgcggagcaagctctgctcgctgtacgagaac
gactgcatctttgacaagttcgagtgctgctggaacggctccgacagcgccatcatgact
ggctcctacaacaacttcttcaggatgtttgacaggagctcgcggagggacgtcacgctg
gaggcctctcgcgagaacagcaagcctcgcgccagcctcaagccccggaaggtgtgcgcg
ggcgggaagaggaagaaggacgagatcagtgtggacagtctggacttcaacaagaagatc
ctgcacacggcctggcacccggtggagaacaccatcgccgtggccgccaccaataacttg
tatatattccaggacaaggccaactag

KEGG   Oryctolagus cuniculus (rabbit): 100355092
Entry
100355092         CDS       T03373                                 
Symbol
PPP2R1A
Name
(RefSeq) protein phosphatase 2 scaffold subunit Aalpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100355092 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100355092 (PPP2R1A)
   04390 Hippo signaling pathway
    100355092 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    100355092 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    100355092 (PPP2R1A)
   04152 AMPK signaling pathway
    100355092 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100355092 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100355092 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100355092 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100355092 (PPP2R1A)
   04730 Long-term depression
    100355092 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100355092 (PPP2R1A)
   05165 Human papillomavirus infection
    100355092 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100355092 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100355092 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100355092 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100355092 (PPP2R1A)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100355092 (PPP2R1A)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100355092 (PPP2R1A)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100355092 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 PDS5 Adaptin_N CLASP_N TAF6_C M11L
Other DBs
NCBI-GeneID: 100355092
NCBI-ProteinID: XP_008248017
Ensembl: ENSOCUG00000017090
LinkDB
Position
Un
AA seq 566 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSTDCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEN
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctctaccccatcgcggtgctcatagacgagctc
cgcaacgaggacgttcagcttcgcctcaacagcatcaagaaactgtccaccatcgcgttg
gccctcggggttgaaaggacccgaagtgagctcctgcccttccttacagacaccatctac
gatgaggatgaggtcctcttggctctggcagaacagctgggaaccttcaccacgctggtg
ggaggcccagagtatgtgcactgcctcctgccacccctggagtcgctggccacggtggag
gagacggtggtgcgggacaaggcggtggagtccctgcgggccatctcacatgagcactcg
ccctccgacctggaggcccacttcgtgccactggtgaagaggctggcgggcggcgactgg
ttcacctcccgcacctccgcctgtggcctcttctctgtctgctacccccgcgtgtccagt
gccgtcaaggcagaacttcgacagtatttccggaacctgtgctcagacgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagttcgccaaggtgctggagctggacaat
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgttggcagtggaggcgtgcgtgaacatcgctcagctcctgccccaggaggacctg
gaggccttggtgatgcccaccctgcgccaggctgctgaggacaagtcctggcgtgtccgc
tacatggtggcagacaagttcacagagctccaaaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacttgatgaaggactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagaattctgtgaaaatctctccaccgactgtcgggagaat
gtgatcatgacccagattttgccctgcatcaaggagctggtgtcagacgccaaccagcac
gtcaagtcagcgctggcctcggtcatcatgggcctctcgcccatcctgggcaaggacaac
accatcgagcacctcctgcccctcttcctggcccagctgaaggatgagtgccctgaagtg
cgactgaacatcatctccaacctggactgcgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccatcgtggagctggctgaggatgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctgctagctgggcagctgggagtggagttctttgat
gagaaactcaactctctgtgcatggcctggctcgtggatcacgtctatgccatccgtgag
gcagccaccagcaacctgaagaagctggtggagaagtttggcaaggagtgggcccatgcc
actatcatccccaaggtcttggccatgtctggagaccccaactacctgcaccgcatgact
acactcttctgcatcaatgtgctgtctgaggtctgtggacaggacatcaccaccaagcac
atgctgcccactgttctgcgtatggctggggacccagttgccaatgtccgcttcaacgtg
gccaagtccctacagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaactga

KEGG   Oryctolagus cuniculus (rabbit): 100355758
Entry
100355758         CDS       T03373                                 
Symbol
PPP2R1B
Name
(RefSeq) protein phosphatase 2 scaffold subunit Abeta
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
ocu04071  Sphingolipid signaling pathway
ocu04114  Oocyte meiosis
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu05142  Chagas disease
ocu05160  Hepatitis C
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100355758 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100355758 (PPP2R1B)
   04390 Hippo signaling pathway
    100355758 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    100355758 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    100355758 (PPP2R1B)
   04152 AMPK signaling pathway
    100355758 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100355758 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100355758 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100355758 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100355758 (PPP2R1B)
   04730 Long-term depression
    100355758 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100355758 (PPP2R1B)
   05165 Human papillomavirus infection
    100355758 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100355758 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100355758 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100355758 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100355758 (PPP2R1B)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100355758 (PPP2R1B)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100355758 (PPP2R1B)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100355758 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Adaptin_N Cnd1 PDS5 CLASP_N M11L AEP1 IFRD
Other DBs
NCBI-GeneID: 100355758
NCBI-ProteinID: XP_002708504
Ensembl: ENSOCUG00000012930
UniProt: G1U2X9
LinkDB
Position
1:104608925..104646239
AA seq 658 aa
MAGAAGPGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASHAIKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTTLASDEQDSVRLLAVEAC
VSIAQLLSQDDLESMVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLHDLIPAFQ
NLLKDCEAEVRAAAAHKVKELCENLPIESRETIIMNQILPYIKELVSDSNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTAALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQ
RLRKLDLPVKDSEELSTSGTDKNHFLRPRAPGEDARKFLPLMSRHKETERRGWLPRRQ
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggcgggcgcggcggggcccggtaccggcccgggggctgcgggcggagatggagacgat
tcgctatatccgatcgcggttttaatcgacgaactccgcaacgaggacgtgcagctccga
ctcaacagtattaagaagttatcaacaattgctctagcacttggagtagaaaggacaaga
actgaactgctgccattccttacagatacaatttatgatgaagatgaggtactgttagct
cttgctgagcagttgggaaatttcactggcctggtgggaggtccagactttgcccactgt
ctgctgcctccgttggaaagtctggcaactgtggaagagactgttgtgcgtgacaaggcc
gtggagtccctgaggcagatctcccaagagcacactcctgttgctctggaagctcatttt
gttcctctggtgaaacgcctagcaagtggggactggttcacctctcgcacgtctgcgtgt
ggtttgttcagcgtttgctatcccagggcttcacatgctatcaaggcagagattagacag
catttccgttccttgtgctcagatgacaccccaatggtacgacgtgctgctgcttccaaa
ttgggtgaatttgcgaaggttttggagttagacagtgtgaaaagtgaaattgttccattg
tttactactctagcttcagatgaacaggattctgtgcgcctcctcgctgtggaagcttgt
gtcagtattgcccaattactatctcaggatgaccttgagtccatggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgtgttcgttatatggtagctgacaaattttca
gagctccagaaagctgtgggtccaaaaatcacactacatgacctcatccccgcctttcag
aacctacttaaagactgtgaagctgaagtccgagcagctgctgcccacaaagtaaaagaa
ctttgtgagaacttgcccattgaaagcagagagaccataattatgaatcaaattctgccc
tacataaaggaactagtatctgatagcaatcagcatgtcaaatcggctctagcttctgta
attatgggattgtctaccattttgggcaaagaaaataccattgaacatcttctacctctt
tttttagctcagttaaaggatgagtgccctgaagttcgtttgaatattatctccaatttg
gattgtgtcaatgaagtgattggaatccgtcagctctcacagtctctccttcctgccata
gtggaactggctgaagatgccaagtggagggtccggctggccatcattgagtatatgccg
ctgttggctggccagctgggtgtggaattctttgatgaaaagctgaattctttgtgtatg
gcctggcttgtggaccacgtgtatgccatccgggaagctgccaccaacaacctcatgaaa
ctagttcagaaatttggcacagagtgggcccaaaataccatcgttcccaaagtattagta
atggcaaatgatcctaattacttgcatagaatgacaacactattctgcattaatgcactg
tctgaagcctgtggtcaggaaataactactaagcaaatgctgcccattgtattaaaaatg
gcaggagaccaagtagcaaatgtccgattcaatgtggccaaatctctacaaaaaattgga
ccaattctagatactgctgctttgcagggggaagttaagccagtactacaaaagttaggt
caagatgaagacatggatgtcaagtactttgcacaggaagctataagtgtggtggcacaa
aggctgaggaagctagatttgcctgtgaaggacagtgaagagctcagcacctctgggacc
gacaagaaccactttctgagacccagagcgcctggagaggacgcccggaagtttttacct
ttgatgtctaggcacaaagagaccgaacggcgcgggtggcttccaaggaggcagtag

DBGET integrated database retrieval system