KEGG   Oryctolagus cuniculus (rabbit): 100009181
Entry
100009181         CDS       T03373                                 
Symbol
INS
Name
(RefSeq) insulin
  KO
K04526  insulin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04911  Insulin secretion
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04917  Prolactin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04940  Type I diabetes mellitus
ocu04950  Maturity onset diabetes of the young
ocu04960  Aldosterone-regulated sodium reabsorption
ocu05010  Alzheimer disease
ocu05215  Prostate cancer
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009181 (INS)
   04014 Ras signaling pathway
    100009181 (INS)
   04015 Rap1 signaling pathway
    100009181 (INS)
   04066 HIF-1 signaling pathway
    100009181 (INS)
   04068 FoxO signaling pathway
    100009181 (INS)
   04072 Phospholipase D signaling pathway
    100009181 (INS)
   04022 cGMP-PKG signaling pathway
    100009181 (INS)
   04151 PI3K-Akt signaling pathway
    100009181 (INS)
   04152 AMPK signaling pathway
    100009181 (INS)
   04150 mTOR signaling pathway
    100009181 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100009181 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009181 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009181 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100009181 (INS)
   04910 Insulin signaling pathway
    100009181 (INS)
   04923 Regulation of lipolysis in adipocytes
    100009181 (INS)
   04913 Ovarian steroidogenesis
    100009181 (INS)
   04914 Progesterone-mediated oocyte maturation
    100009181 (INS)
   04917 Prolactin signaling pathway
    100009181 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100009181 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100009181 (INS)
   04213 Longevity regulating pathway - multiple species
    100009181 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100009181 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009181 (INS)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100009181 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100009181 (INS)
   04940 Type I diabetes mellitus
    100009181 (INS)
   04950 Maturity onset diabetes of the young
    100009181 (INS)
   04932 Non-alcoholic fatty liver disease
    100009181 (INS)
   04931 Insulin resistance
    100009181 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 100009181
NCBI-ProteinID: NP_001075804
Ensembl: ENSOCUG00000000243
UniProt: P01311
LinkDB
Position
Un
AA seq 110 aa
MASLAALLPLLALLVLCRLDPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKSRREVEE
LQVGQAELGGGPGAGGLQPSALELALQKRGIVEQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggcctccctggccgcgctcctgcccctgctggccctgctggtcctctgcagactggat
cctgcccaggccttcgtcaaccagcacctgtgcggctctcacctggtggaggcgctgtac
ctggtgtgcggggagcgcggctttttttatacacccaagtcccgccgcgaggtggaggag
ctgcaggtggggcaggcggagctgggcggggggcccggcgcgggcggcctgcagccctcg
gcgctggagctggccctgcagaagcgcggcatcgtggagcagtgttgcaccagcatctgc
tcgctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system