KEGG   Oryctolagus cuniculus (rabbit): 100009192
Entry
100009192         CDS       T03373                                 
Symbol
GRO-G, GRO
Name
(RefSeq) GRO gamma protein
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05134  Legionellosis
ocu05146  Amoebiasis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100009192 (GRO-G)
   04668 TNF signaling pathway
    100009192 (GRO-G)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009192 (GRO-G)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100009192 (GRO-G)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100009192 (GRO-G)
   04657 IL-17 signaling pathway
    100009192 (GRO-G)
   04062 Chemokine signaling pathway
    100009192 (GRO-G)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009192 (GRO-G)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100009192 (GRO-G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009192 (GRO-G)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009192 (GRO-G)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009192 (GRO-G)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100009192 (GRO-G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009192 (GRO-G)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100009192 (GRO-G)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100009192
NCBI-ProteinID: NP_001075811
UniProt: P47854
LinkDB
AA seq 104 aa
MAPAATAAAPRLLRAALLLLLLVAAGRRAAGAPVVNELRCQCLQTLQGIHLKNIQSVKVT
TPGPHCDQTEVIASLKTGQEVCLNPTAPVVKKIIDKMLNKASAN
NT seq 315 nt   +upstreamnt  +downstreamnt
atggccccagccgcgaccgccgccgccccccggctcctccgcgcagcactgctgctcctg
ctcctggtggccgccggccggcgcgcagcaggggcgcccgtggtcaacgaactgcgctgc
cagtgcctgcagaccttgcaggggattcacctcaagaacatccagagcgtgaaggtgaca
acccccggcccccactgcgaccaaaccgaagtcatagccagtctcaagactggtcaggaa
gtgtgtctcaaccccaccgcccccgtggttaagaaaatcatcgataagatgctaaacaag
gctagtgccaactga

KEGG   Oryctolagus cuniculus (rabbit): 100009245
Entry
100009245         CDS       T03373                                 
Symbol
GRO-A
Name
(RefSeq) GRO
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05134  Legionellosis
ocu05146  Amoebiasis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100009245 (GRO-A)
   04668 TNF signaling pathway
    100009245 (GRO-A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009245 (GRO-A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100009245 (GRO-A)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100009245 (GRO-A)
   04657 IL-17 signaling pathway
    100009245 (GRO-A)
   04062 Chemokine signaling pathway
    100009245 (GRO-A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009245 (GRO-A)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100009245 (GRO-A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009245 (GRO-A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009245 (GRO-A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009245 (GRO-A)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100009245 (GRO-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009245 (GRO-A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100009245 (GRO-A)
SSDB
Motif
Pfam: IL8 Lenti_VIF_2
Other DBs
NCBI-GeneID: 100009245
NCBI-ProteinID: NP_001075855
UniProt: Q28724
LinkDB
Position
15:complement(76146658..76148421)
AA seq 108 aa
MAPAACPAAAPSGPRFLRTAMLLLLLLAASRRAAGAAALTELRCQCLQTVQGIHLKSIQS
LKVLSPGPHCAQTEVIATLKSGQEACLNPAAPMVKKFLQKRLSKGSSN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcccccgccgcgtgccccgccgccgcgcccagcggtccccggttcctgcggaccgcg
atgctgctgctgctgctgctggccgccagccggcgcgcagcaggggcggccgcgctcacc
gagctgcgctgccagtgtctgcagaccgtgcagggcattcacctcaagagcatccagagc
ctgaaggtgctgtcgccgggcccgcactgcgcccagaccgaagtcatagccacgctcaag
tccgggcaggaagcttgtctcaaccccgccgcccccatggtgaagaaattcctgcagaag
aggctcagcaagggcagcagcaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100328583
Entry
100328583         CDS       T03373                                 
Symbol
GRO-B, RPF2
Name
(RefSeq) GRO beta protein
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05134  Legionellosis
ocu05146  Amoebiasis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100328583 (GRO-B)
   04668 TNF signaling pathway
    100328583 (GRO-B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328583 (GRO-B)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100328583 (GRO-B)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100328583 (GRO-B)
   04657 IL-17 signaling pathway
    100328583 (GRO-B)
   04062 Chemokine signaling pathway
    100328583 (GRO-B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100328583 (GRO-B)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100328583 (GRO-B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100328583 (GRO-B)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100328583 (GRO-B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100328583 (GRO-B)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100328583 (GRO-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100328583 (GRO-B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100328583 (GRO-B)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100328583
NCBI-ProteinID: XP_002717067
Ensembl: ENSOCUG00000024425
LinkDB
Position
15:complement(76261333..76263578)
AA seq 192 aa
MLGPHPGVPHSYAGGRGRCHSSVTRDPPGASGIPRAPGLPLFPPRMGIKGVLRSQRATEP
GRPHQPQLPRSRSPRRRHPAAGVPWPPRPRAPPRPALPGLLRTALLLLLLLAASRRAAGA
PALTELRCQCLQTVQGIHLKNIQNLKVLSPGPHCAQTEVIATLKSGQEACLNPAAPMVKK
FLQKRLSNGNSS
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcttggcccccaccccggggtcccgcacagttacgcaggagggcggggccggtgtcat
tcttccgtgaccagagatccaccaggagcttcgggaattccccgggccccggggctccca
cttttcccgccccgaatgggcataaaaggggttctccgatcgcagcgagccacagagccc
ggacggccacaccagccacagctgcctcgctccagatccccccgccgccgccaccctgcc
gccggagtcccatggcccccccgcccgcgtgccccgccgcgcccagcgctccccgggctc
ctgcggaccgcgctgctgctgctgctgctgctggccgccagcaggcgagcagcaggggcg
cccgcgctcaccgagctgcgctgccagtgtctgcagaccgtgcagggcattcacctcaag
aacatccagaacctgaaggtgctgtcgccgggcccgcactgcgcccagaccgaagtcata
gccacgctcaagtccgggcaggaagcttgtctcaaccccgccgcccccatggtgaagaaa
ttcctgcagaagaggctcagcaatggcaactccagctga

DBGET integrated database retrieval system