KEGG   Oryctolagus cuniculus (rabbit): 100009201
Entry
100009201         CDS       T03373                                 
Symbol
ADCY2
Name
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100009201 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100009201 (ADCY2)
   04371 Apelin signaling pathway
    100009201 (ADCY2)
   04020 Calcium signaling pathway
    100009201 (ADCY2)
   04072 Phospholipase D signaling pathway
    100009201 (ADCY2)
   04024 cAMP signaling pathway
    100009201 (ADCY2)
   04022 cGMP-PKG signaling pathway
    100009201 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009201 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100009201 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009201 (ADCY2)
   04062 Chemokine signaling pathway
    100009201 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    100009201 (ADCY2)
   04922 Glucagon signaling pathway
    100009201 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    100009201 (ADCY2)
   04912 GnRH signaling pathway
    100009201 (ADCY2)
   04913 Ovarian steroidogenesis
    100009201 (ADCY2)
   04915 Estrogen signaling pathway
    100009201 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    100009201 (ADCY2)
   04921 Oxytocin signaling pathway
    100009201 (ADCY2)
   04926 Relaxin signaling pathway
    100009201 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    100009201 (ADCY2)
   04918 Thyroid hormone synthesis
    100009201 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    100009201 (ADCY2)
   04916 Melanogenesis
    100009201 (ADCY2)
   04925 Aldosterone synthesis and secretion
    100009201 (ADCY2)
   04927 Cortisol synthesis and secretion
    100009201 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009201 (ADCY2)
   04270 Vascular smooth muscle contraction
    100009201 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    100009201 (ADCY2)
   04971 Gastric acid secretion
    100009201 (ADCY2)
   04972 Pancreatic secretion
    100009201 (ADCY2)
   04976 Bile secretion
    100009201 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100009201 (ADCY2)
   04727 GABAergic synapse
    100009201 (ADCY2)
   04725 Cholinergic synapse
    100009201 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    100009201 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100009201 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    100009201 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    100009201 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100009201 (ADCY2)
   04714 Thermogenesis
    100009201 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009201 (ADCY2)
   05207 Chemical carcinogenesis - receptor activation
    100009201 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009201 (ADCY2)
   05163 Human cytomegalovirus infection
    100009201 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    100009201 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100009201 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009201 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100009201 (ADCY2)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100009201 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom AC_N HNOBA
Other DBs
NCBI-GeneID: 100009201
NCBI-ProteinID: XP_008247060
Ensembl: ENSOCUG00000008557
LinkDB
Position
Un
AA seq 1101 aa
MGAGSRWTAAAAPAPAGAPGATAAGTAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVF
LLLIVMAACLALLAVFFALSLEVEDHVAFLITVPTALAIFFAIFILVCVEAVFKKLLRLF
SLVIWICLVAMGFLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSH
TIVLSICLSASPGAKEHLVWQILANVIIFICGNLAGAYHKQLMELALQQTYRDTCNCIKS
RIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGHMENTNNFHNLYVKRHTNV
SILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPI
SLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHD
VTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGE
RRSPHLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPM
GQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEK
EYRATALPAFKYYVTCACLIFFCIFLVQILVLPKTSILGISFGAAFLSLAFILFVCFAGQ
LLQCSKKASASLMWLLKSSGIIANRPWPRISLTVITTAIILTMAVFNMFFLSDSEEAILP
TANTSNTSFPASSNQAAILRAQSLFFLPYFIYCCILGLISCSVFLRINYELKMLIMMVAL
VAYNILLLHTHAHVLDDYSQVLFERPGIWKDLKTMGSVSLSIFFVTLLVLGRQNEYYCRL
DFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMF
ASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATG
LSAVPSQEHAQEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGV
IGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGD
LKTYFVNTEMSRSLSQSNVAS
NT seq 3306 nt   +upstreamnt  +downstreamnt
atgggggctgggagccgatggacagcggcggcggccccagccccggcgggggcccccggg
gcgacggcggcggggacggcggcggcggcggcgggcggcggcgaggggctgcagcggtcc
cgggactggctgtacgagtcctactactgcatgagccagcagcacccgctcatcgtcttc
ctgctgctcatcgtcatggcggcctgcctcgccctgctcgccgtcttcttcgccctgtct
ttggaagtggaggaccatgtggcatttttaatcacagtccccaccgccctggcgattttc
tttgccatattcatcctggtgtgcgttgaggccgtgtttaagaagctgctccgcctcttc
tccttggtgatatggatctgcctggtagccatggggttcctgttcatgtgctttggaggc
actgtctctccctgggaccaggtgtctttcttcctcttcatcatcttcgtggtgtacacc
atgctgcccttcaacatgcgagacgccatcatcgccagcgtcctcacctcctcttcccac
accatcgtgctgagcatctgcctgtctgcatcgccaggggccaaggagcatctggtctgg
cagatcctggccaacgtgatcatcttcatctgcgggaacctggcaggagcctaccacaag
cagctcatggagctggcgctgcagcagacctaccgagacacctgcaactgcatcaagtcc
cggatcaagctggaattcgagaagcgtcagcaggagcggctgctgctctccttgctgcca
gctcacatcgccatggaaatgaaggcggagatcatccagagactgcaaggccccaaggcg
ggccacatggaaaacacgaacaacttccacaacctgtacgtgaagcggcacaccaacgtc
agcatcttatacgccgacatcgtgggctttacccggctggcgagtgactgctccccagga
gaactggtccatatgctgaatgagctctttggaaagtttgatcagattgcaaaggagaat
gaatgcatgagaattaaaatcttaggagactgctattactgtgtgtccggactccccata
tctctccccaaccatgccaagaattgtgtgaaaatgggactggatatgtgtgaagccata
aagaaagtcagggatgccactggagttgacatcaacatgcgtgtgggagtgcattctggg
aacgtgctgtgtggcgtgattggtctgcagaaatggcagtacgacgtgtggtcacatgat
gtcaccttggccaatcacatggaggctggcggagtccctggacgtgtccacatttcttca
gtcaccctggagcacctgaatggcgcctacaaggtggaggagggagatggtgacatcagg
gacccatatttgaaacagcacctggtgaaaacctacttcgtcatcaacccaaagggagag
cggcggagtccccatctcttcagacctcgccacaccctcgatggagccaagatgagggcg
tctgtgcgcatgacccggtacctggagtcctggggtgcagccaagccctttgcgcacctg
catcacagagacagcatgaccaccgagaatggcaagatcagcaccacggatgtgccaatg
ggtcagcataattttcagaatcgcaccttaagaaccaagtcacaaaagaaaaggtttgaa
gaagaattgaatgaaaggatgattcaagcaattgatggaatcaatgcacaaaagcaatgg
ctcaaatctgaagatatccaaagaatctcactgcttttctataacaaaatactcgaaaaa
gaataccgagccactgcactgccggcattcaagtactatgtgacttgtgcgtgtctcata
ttcttctgcatctttctcgtgcagattctcgtattgccaaaaacgtccatccttgggatt
tcctttggagctgcatttctctcgcttgcctttatccttttcgtctgctttgctggacag
cttttgcaatgcagcaaaaaagcctctgcgtctctcatgtggcttttgaagtcctcaggc
atcattgccaaccgcccctggccgcgcatctccctcacggtcatcaccacggccatcatc
ttgaccatggctgtgttcaacatgttcttcctgagtgactcagaggaagcaatccttcca
actgccaatacttcaaacacaagtttccccgcctcaagcaatcaggcagcgattctgcgc
gcacaaagcttatttttcctcccgtatttcatctactgctgcattctgggcttgatctcc
tgttcggttttcctgcggataaattatgagttgaaaatgttgatcatgatggtggccttg
gtggcctacaacatcctcctactccacacccacgcccacgtcctggacgactacagccag
gtcttgtttgagaggccaggcatttggaaagacctgaagaccatgggctcagtgtctctc
tctatatttttcgtcactctgctggtcctgggaagacagaatgaatattactgtaggttg
gacttcctgtggaagaacaagttcaaaaaagagcgggaggagatagaaaccatggagaac
ctgaaccgtgtgctgctggagaacgtgcttccggcccacgtggctgagcacttcctggcc
cgcagcctgaagaacgaggagttgtaccaccagtcctacgactgtgtctgcgtcatgttt
gcctccatcccggatttcaaagaattctacaccgagtcggatgtgaacaaggaaggcctg
gaatgcctgcggctcctgaacgagatcatcgctgactttgatgatctgctgtccaagcca
aaattcagtggcgttgaaaagatcaagaccatcggcagcacgtacatggcagcgacgggt
ctgagtgccgtgcccagccaggagcacgcccaggagcccgagcggcagtacatgcacatt
ggcacgatggtggagtttgcttttgccctggtggccaaactggatgccatcaacaagcac
tccttcaacgacttcaagctgcgagtgggcattaaccacggacctgtgatcgctggtgtc
atcggagcccagaagccccagtacgacatctggggcaacacagtcaacgtggccagcagg
atggacagcaccggagtcctggacaagatacaggtgaccgaggagaccagcctcatcctg
cagacgcttgggtacacgtgcacctgccgagggatcatcaacgtgaagggcaagggggac
ctgaagacgtactttgtcaacacagaaatgtcaaggtccctgtcccagagcaacgtggcc
tcctga

KEGG   Oryctolagus cuniculus (rabbit): 100009315
Entry
100009315         CDS       T03373                                 
Symbol
ADCY5, RUT
Name
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05012  Parkinson disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100009315 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100009315 (ADCY5)
   04371 Apelin signaling pathway
    100009315 (ADCY5)
   04072 Phospholipase D signaling pathway
    100009315 (ADCY5)
   04024 cAMP signaling pathway
    100009315 (ADCY5)
   04022 cGMP-PKG signaling pathway
    100009315 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009315 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100009315 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009315 (ADCY5)
   04062 Chemokine signaling pathway
    100009315 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    100009315 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    100009315 (ADCY5)
   04912 GnRH signaling pathway
    100009315 (ADCY5)
   04913 Ovarian steroidogenesis
    100009315 (ADCY5)
   04915 Estrogen signaling pathway
    100009315 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    100009315 (ADCY5)
   04921 Oxytocin signaling pathway
    100009315 (ADCY5)
   04926 Relaxin signaling pathway
    100009315 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    100009315 (ADCY5)
   04918 Thyroid hormone synthesis
    100009315 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    100009315 (ADCY5)
   04916 Melanogenesis
    100009315 (ADCY5)
   04924 Renin secretion
    100009315 (ADCY5)
   04925 Aldosterone synthesis and secretion
    100009315 (ADCY5)
   04927 Cortisol synthesis and secretion
    100009315 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009315 (ADCY5)
   04270 Vascular smooth muscle contraction
    100009315 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    100009315 (ADCY5)
   04971 Gastric acid secretion
    100009315 (ADCY5)
   04972 Pancreatic secretion
    100009315 (ADCY5)
   04976 Bile secretion
    100009315 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    100009315 (ADCY5)
   04727 GABAergic synapse
    100009315 (ADCY5)
   04725 Cholinergic synapse
    100009315 (ADCY5)
   04728 Dopaminergic synapse
    100009315 (ADCY5)
   04726 Serotonergic synapse
    100009315 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    100009315 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100009315 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    100009315 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    100009315 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100009315 (ADCY5)
   04714 Thermogenesis
    100009315 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009315 (ADCY5)
   05207 Chemical carcinogenesis - receptor activation
    100009315 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009315 (ADCY5)
   05163 Human cytomegalovirus infection
    100009315 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100009315 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    100009315 (ADCY5)
   05031 Amphetamine addiction
    100009315 (ADCY5)
   05032 Morphine addiction
    100009315 (ADCY5)
   05034 Alcoholism
    100009315 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100009315 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009315 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100009315 (ADCY5)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100009315 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc Adcy_cons_dom HNOBA TBK1_ULD DUF2339 GBR2_CC
Other DBs
NCBI-GeneID: 100009315
NCBI-ProteinID: NP_001076097
Ensembl: ENSOCUG00000015141
UniProt: P40144
LinkDB
Position
14:95675819..95837536
AA seq 1264 aa
MSGSKGVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQQQQRLASRWRGDDDDEPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRR
QRRGAAGGGSTRAPPAGGGCGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRAVDELEA
GAVEGGEGAEDGGSSADSSNGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRL
NQSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDH
MGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLL
STLHLAIALRTNAQDRFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQA
RLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEG
FTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCC
VEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEA
GGKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIA
KMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESTNPEDEVD
EFLGRAIDARSIDRLRSEHVRRFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICC
VQITIVPHSMFMLSFYLACFLLLTLVVFVSMIYSCVKLFPRPLQSLSRKIVRSKMNSTLV
GVFTITLVFLSAFVNMFMCNSKDLLDCLAAEHNISVIHVNACHVVESAFNYSLGNEQGFC
GNSRPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELTYVLIVEVPRVTLFDN
ADLLVTANAIDISSNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFL
WKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASI
ANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLND
STYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYD
IWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGG
PPLS
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaggcgtgagccctccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggccccgaacatcgctcagcttggggggaggccgactctcgtgccaat
ggctacccccacgcccccgggggttctgctcgcggctccaccaagaaaccagggggggcg
gtgaccccacagcagcagcaacagcagcagcgcctggccagccgctggcgcggcgacgac
gacgacgagccgccgttgagcggcgacgatcccttggccgggggcttcggctttagcttc
cgctccaagtccgcctggcaggagcgcggcggcgacgactgcggtcgcggcagccggcgg
cagcggcggggcgcggccggcgggggcagcactcgggcgccccctgcgggcggcggctgc
ggcggcggctcggcggcagcggccgctgcggcgggcgggacggaggtgcgcccccgttcg
gtggagctgggcctggaggagcggcgaggcaagggccgcgcggtggacgagctggaggcc
ggtgccgtcgagggcggtgaaggggcagaggatggcggcagctccgcggactccagcaac
gggcccggcgcggtgctgtcgctgggcgcctgctgcctggcgttgctgcagattttccgc
tccaagaagttcccgtccgacaagctggagcggctgtaccagcgctacttcttccgcctg
aaccagagcagcctcaccatgctcatggccgtgctggtgctcgtgtgcctcgtcatgctg
gccttccacgcggcgcgccccccactccagctgccctacctggcggtgctggcggccgcc
gtgggcgtgatcctcgtcatggccgtgctgtgcaaccgcgcagccttccaccaggaccac
atgggcctggcctgctatgcgctcatcgccgtggtgctggctgtccaggtggtgggcctg
ctgctgccccagccgcgcagtgcctccgagggcatctggtggaccgtgttcttcatctac
accatctacacgctgctgcctgtgcgcatgcgggctgcggtcctcagcggggtgctcctg
tccaccctgcacctggccatcgccctgcgcaccaacgcccaggaccggttcctgctcaag
cagctggtctccaacgtcctcatcttctcctgcaccaacattgtgggcgtctgcacccac
tatccggccgaggtctcccagaggcaggccttccaggagacccgcgagtgcatccaggca
cggctccactcgcagcgggagaaccagcaacaggagcggctcctgctgtccgtccttccc
cgccacgttgccatggagatgaaagcagacatcaatgccaagcaggaggatatgatgttc
cataagatctacatccagaaacatgacaacgtgagcatcctgttcgctgacattgagggc
ttcaccagcctggcgtcccagtgcaccgcccaggagctggtcatgaccctcaacgagctc
ttcgcccgcttcgacaagctggctgcggagaatcactgtttacgcattaagatcctgggg
gattgctactactgcgtgtcggggctgcccgaagccagggccgaccacgcccactgctgc
gtggagatgggcatggacatgatcgaggccatctcgttggtccgggaggtgacgggcgtg
aacgtgaacatgcgcgtgggaattcacagcggccgagtgcactgcggtgtccttggcctg
aggaagtggcagttcgacgtatggtctaatgacgtcacgctggccaaccacatggaggcc
ggcggcaaggcaggacgcatccacatcaccaaggccaccctcaactacctgaacggcgac
tacgaggtggagccaggctgcgggggcgagcgcaacgcctacctcaaggagcacagcatc
gagaccttcctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgcc
aagatgaaccgccagcgaaccaactccatcgggcacaacccgccacactggggggccgag
cgccccttctacaaccacctgggtggcaaccaggtctccaaggagatgaagcggatgggc
tttgaagaccccaaggacaagaacgcccaggagagtacgaaccccgaggatgaagtggat
gagtttctgggccgggcaatcgacgccaggagcatcgacaggctgcggtccgagcacgtc
cgcaggttcctcttgaccttcagggagcctgacttagagaagaagtactccaagcaggtg
gacgaccgctttggtgcctacgtggcgtgtgcctcgctcgtcttcctcttcatctgctgt
gtccagatcaccatcgtgccccactccatgttcatgctgagtttctacctggcctgcttc
ctgctgctgaccttggtggtgtttgtgtccatgatctactcctgcgtgaagctcttcccg
cgcccgctgcagagcctgtccaggaagatcgtgcgctccaagatgaacagcaccctggtc
ggagtgttcaccatcaccctggtgttcctgtcggctttcgtcaacatgttcatgtgcaac
tccaaggatctgctggactgcctggcggcggagcacaacatcagcgtgatccatgtcaac
gcgtgccacgtggtggagtcggccttcaactacagcctgggcaacgagcagggcttctgt
ggcaactccaggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagc
ctgctggcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctg
gccatcgagctcacctacgtgctcatcgtcgaggtgccccgggtcacgctctttgacaat
gccgacctgctggtcaccgccaacgccatagacatcagcagcaacgggacctcccagtgc
ccggagcacgcgaccaaggtggcgctgaaggtggtgacgcccatcataatctccgtcttt
gtgctggccctgtacctgcacgcccagcaggtggagtccaccgcccgcctggacttcctc
tggaaactgcaggccacggaggagaaggaggagatggaggagctgcaggcctacaaccgg
cggctgctgcacaacatcctgcccaaggacgtggccgcccacttcctggcccgcgagcgg
cgcaatgacgagctgtactaccagtcctgcgagtgcgtggccgtcatgttcgcctccatc
gccaacttctccgagttctacgtggagctagaggccaacaacgagggcgtcgagtgcctg
cggctgctgaacgagatcatcgccgactttgacgagatcatcagtgaggatcggttcagg
cagctggagaagattaagaccatcggcagcacctacatggccgcctcgggcctcaacgac
tccacctacgacaaggtgggcaagacacacatcaaagcgctggccgacttcgccatgaag
ctgatggaccaaatgaaatacatcaacgagcactccttcaacaacttccagatgaagatc
ggactcaacattggccccgtggtggctggggtgatcggggcacgtaagccccagtacgac
atctggggcaacacagtgaacgtggccagccgtatggacagcaccggcgtgcccgaccgc
atccaggtcaccacggacatgtaccaggtgctggccgccaacacataccagctggagtgc
cggggtgtggtcaaggtcaagggcaaaggcgagatgatgacgtacttcctcaacggcggg
cccccgctcagttag

KEGG   Oryctolagus cuniculus (rabbit): 100337882
Entry
100337882         CDS       T03373                                 
Symbol
ADCY8
Name
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100337882 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100337882 (ADCY8)
   04371 Apelin signaling pathway
    100337882 (ADCY8)
   04020 Calcium signaling pathway
    100337882 (ADCY8)
   04072 Phospholipase D signaling pathway
    100337882 (ADCY8)
   04024 cAMP signaling pathway
    100337882 (ADCY8)
   04022 cGMP-PKG signaling pathway
    100337882 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100337882 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100337882 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100337882 (ADCY8)
   04062 Chemokine signaling pathway
    100337882 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    100337882 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    100337882 (ADCY8)
   04912 GnRH signaling pathway
    100337882 (ADCY8)
   04913 Ovarian steroidogenesis
    100337882 (ADCY8)
   04915 Estrogen signaling pathway
    100337882 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    100337882 (ADCY8)
   04921 Oxytocin signaling pathway
    100337882 (ADCY8)
   04926 Relaxin signaling pathway
    100337882 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    100337882 (ADCY8)
   04918 Thyroid hormone synthesis
    100337882 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    100337882 (ADCY8)
   04916 Melanogenesis
    100337882 (ADCY8)
   04925 Aldosterone synthesis and secretion
    100337882 (ADCY8)
   04927 Cortisol synthesis and secretion
    100337882 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100337882 (ADCY8)
   04270 Vascular smooth muscle contraction
    100337882 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    100337882 (ADCY8)
   04971 Gastric acid secretion
    100337882 (ADCY8)
   04972 Pancreatic secretion
    100337882 (ADCY8)
   04976 Bile secretion
    100337882 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    100337882 (ADCY8)
   04727 GABAergic synapse
    100337882 (ADCY8)
   04725 Cholinergic synapse
    100337882 (ADCY8)
   04720 Long-term potentiation
    100337882 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    100337882 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    100337882 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    100337882 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    100337882 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    100337882 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100337882 (ADCY8)
   04714 Thermogenesis
    100337882 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337882 (ADCY8)
   05207 Chemical carcinogenesis - receptor activation
    100337882 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100337882 (ADCY8)
   05163 Human cytomegalovirus infection
    100337882 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    100337882 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100337882 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100337882 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100337882 (ADCY8)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100337882 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom TBK1_ULD
Other DBs
NCBI-GeneID: 100337882
NCBI-ProteinID: XP_002710595
Ensembl: ENSOCUG00000002685
UniProt: G1SI32
LinkDB
Position
3:complement(146490149..146740431)
AA seq 1251 aa
MELSDVRFLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGGGGG
GSGGSGKGSNPAGCGSNHHAPQLSGESALPLYSLGPGERAHSTGGSKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVVLQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPED
IVKESVSPSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITTIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINE
NYLARNVIIFASILINFLGAVLNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPTGPEPGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgcttccttagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcggctcccggccgcagcggctgctgtggcagacg
gcggtgcggcacatcaccgagcagcgtttcattcatgggcaccggggcggcggcggcggc
gggagcggaggctccgggaaaggctcgaaccctgcgggctgcggctccaaccaccacgca
cctcagctgtccggcgagtccgcgctgccgctctactcgctgggccccggggagcgggcg
cacagcaccggtggctccaaagtcttcccggaacgcagcgggagcggcagcgccagtggc
agcgggggtgggggtgacctgggcttcctgcaccttgactgcgccccgagcaactccgat
ttctttctcaatgggggctatagctatcgaggggtcattttccccaccttgcgcaactcc
ttcaagtcccgggatctggaacgcctgtaccagcgctatttcctgggccaaaggcgcaag
tcggaggtggtgatgaacgtgctggatgtgctgaccaaactcaccctcctggtcctgcac
ttgagcctggcctcagcacccatggacccgctcaaaggcatcctgttgggcttcttcact
ggcatcgaggtggtgatctgtgccctggtggtggtcaggaaggacaccacctcgcacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctggcagca
ggtctcggctacgggcttctaggtgatggcataggctacgtgctcttcacgctcttcgcc
acgtacagcatgctgccgctgccgcttacctgggccattctggctggcctgggcacctcg
ctgctgcaggtggtcctccaagtagtcatccctcggctggcagtcatttccatcaaccag
gttgtggcccaggcagtgctattcatgtgtatgaacacggctggaatcttcatcagttac
ctctcagaccgggcccagcgtcaagccttcctggaaacgcggaggtgtgtggaggccagg
ctacgcctggagacagagaatcaaagacaggagcggctcgtgctgtctgtgctaccccga
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagatgagcacctgcagcac
cagttccatcgaatctacatccatcgttatgagaacgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtccgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatc
ctgggagactgctactactgtgtttccggactgcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtccggtcgaggaca
aagcatgatgtggatatgaggattggaatccactcgggctccgtgctatgtggtgtgctg
ggcctgaggaagtggcagtttgatgtctggtcttgggatgtggacattgcaaataaactg
gaatctggaggaatccctgggagaattcacatttccaaagccaccctggactgcctcaat
ggtgactataatgtggaagaaggccatggaaaagaacgaaatgagttcttgaggaagcat
aatatagagacctatttaattaagcagcctgaggagagtctgctctccctgccggaagac
atcgtcaaggaatcggtgagcccctctgacaggagaaacagtggggcaacattcactgaa
ggatcctggagccccgaactgccctttgataacattgtggggaagcagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttagtctgtgcattt
attgttcttctatttatcacgacaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcagctctggtcctgatcaccaca
gcagaggattataagtgtttgcccctggtcctgaggaaaacttgctgttggattaacgag
aactacttggcccggaacgtcatcatctttgcctccatcttgattaatttcctgggagcc
gtcctaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcaccgga
gtgttggccatggtgacctgtgcagtgttcctccgacttaactctgtcctgaagctagct
gtgctgctaatcatgatcgccatctatgccctgctgacagagaccatctacgctggcctc
tttctgcgttatgacaacttgaaccacagtggcgaagatttcctggggaccaaagaagca
tcactgttgctaatggccatgttcctccttgctgtattctaccacggacagcagctggag
tacacagcccgcctggacttcctctggcgagtacaggccaaggaggagatcaatgaaatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccacgtggcc
cgacatttcctggagaaagaccgagacaatgaggaactgtactctcaatcctatgatgcc
gttggggtgatgtttgcctccatcccaggatttgcagacttttactctcagactgaaatg
aataaccagggagtggaatgcctacggttgctgaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccggttccaggacattgaaaagatcaaaaccattggcagcacttac
atggccgtgtcaggcctgtcaccagaaaaacagcaatgtgaagacaagtggggacatttg
tgtgccctggccgacttctctctcgccctcactgaaagcatacaggagatcaacaagcat
tccttcaacaattttgaactccggatcggcatcagccatggctcagtggttgctggtgtg
attggcgctaagaaacctcaatatgacatttggggcaaaaccgtgaacctggccagccga
atggacagcacaggggtgagcggacggatccaagtgccagaggagacctatctcatcctc
aaggaccagggctttgcctttgactaccgaggggagatctacgtgaaaggcatcagtgaa
caggaagggaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactacccgggcagtactccttggctgcagtcgttctgggccttgtc
cagtccctcaaccggcaaaggcagaagcagctactcaatgagaacaacaacacggggatc
atcaaaggccattacaaccgacggactttgctgactcccactgggccggagcctggggcc
caagctgaaggcactgacaaatccgatttgccataa

KEGG   Oryctolagus cuniculus (rabbit): 100340877
Entry
100340877         CDS       T03373                                 
Symbol
ADCY9
Name
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04962  Vasopressin-regulated water reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100340877 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100340877 (ADCY9)
   04371 Apelin signaling pathway
    100340877 (ADCY9)
   04020 Calcium signaling pathway
    100340877 (ADCY9)
   04072 Phospholipase D signaling pathway
    100340877 (ADCY9)
   04024 cAMP signaling pathway
    100340877 (ADCY9)
   04022 cGMP-PKG signaling pathway
    100340877 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100340877 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100340877 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340877 (ADCY9)
   04062 Chemokine signaling pathway
    100340877 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    100340877 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    100340877 (ADCY9)
   04912 GnRH signaling pathway
    100340877 (ADCY9)
   04913 Ovarian steroidogenesis
    100340877 (ADCY9)
   04915 Estrogen signaling pathway
    100340877 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    100340877 (ADCY9)
   04921 Oxytocin signaling pathway
    100340877 (ADCY9)
   04926 Relaxin signaling pathway
    100340877 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    100340877 (ADCY9)
   04918 Thyroid hormone synthesis
    100340877 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    100340877 (ADCY9)
   04916 Melanogenesis
    100340877 (ADCY9)
   04925 Aldosterone synthesis and secretion
    100340877 (ADCY9)
   04927 Cortisol synthesis and secretion
    100340877 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100340877 (ADCY9)
   04270 Vascular smooth muscle contraction
    100340877 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    100340877 (ADCY9)
   04971 Gastric acid secretion
    100340877 (ADCY9)
   04972 Pancreatic secretion
    100340877 (ADCY9)
   04976 Bile secretion
    100340877 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100340877 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100340877 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    100340877 (ADCY9)
   04727 GABAergic synapse
    100340877 (ADCY9)
   04725 Cholinergic synapse
    100340877 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    100340877 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100340877 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    100340877 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    100340877 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100340877 (ADCY9)
   04714 Thermogenesis
    100340877 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340877 (ADCY9)
   05207 Chemical carcinogenesis - receptor activation
    100340877 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100340877 (ADCY9)
   05163 Human cytomegalovirus infection
    100340877 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    100340877 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100340877 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100340877 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100340877 (ADCY9)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100340877 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom DUF512 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 100340877
NCBI-ProteinID: XP_017193707
Ensembl: ENSOCUG00000007904
LinkDB
Position
Un
AA seq 1352 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSCSSHPKHCKYSISSSCSSSGDS
AGAPRRLGGGARLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSVYFAVHTRSKLIVMVAPALCFLAACVGFFLFTFTKLYARHYAWTSLVLT
LLVFALTLAAQFQALTPLAGRADSSNHTPAAQPADTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVAYSVLFETFGYHFRNEDCFPWPGAPVLHWELLSRALLHLCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVFERLGQSVVADQLKGLKTYLISGQRAKESQCSCAEALLSGFEVIDGSRVS
SGPRGQGTASSGSVSDLAQTVKTFDNLKTCPSCGITFAPKAEAGAEGGTVQNGCQDEPQG
GTKASGGPSSKAQNGLLSPPQQEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDPELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLVLSATCFLKYGAAATPPPPAALAVFGAALLLEVLSLVVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCVGAVLVSLPALAVYSHVTSEFETNIHFPVVTGS
AVLVAVVHYCNFCQLSSWMRSSLATIVGAGPLLLLYISLCPDSPIVVSPLDAVQNFSSGR
SPCNSSLLQDSKRPASLVGEELILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTTQCQDSSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDNGVVPQHQLSISP
DIRVQVDGSIGRSPTDEIATLVPSVQYSDKTSLGCENAQARDAHPSSKRPWKEPIKAEER
CRFGKAIEKDDCEDVGLEEANELTKLDVSKSV
NT seq 4059 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcatcaccacagcaccgaggtgagctgtgac
tccagcggcgacagcaacagcgtgcgggtcaagatcaaccccaagcagctgtcctgcagc
agccaccccaagcactgcaagtacagcatctcctccagctgcagcagctcgggggactcc
gcgggcgcgccccgcaggctgggcggcggggcccgcctgcgccggcagaagaagctgccg
cagctgttcgagagggcctcgagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccgcttccggtacgcgctc
ttctacgtcggcttcgcctgcctgctctggagcgtctatttcgccgtccacacgagatcc
aagctgattgtcatggtggcgccggcgctctgcttcctcgcggcgtgtgtgggctttttt
ctgtttaccttcaccaagctgtacgcccggcattacgcctggacctcgctggttctcacc
ctgctggtgttcgccctgaccctggctgcgcagtttcaggctttgacgcctctggcgggc
cgtgctgacagctccaatcacactcccgcggcccagcccgcagacacctgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctctgtacttgagcttgtttctgggggtggcctattctgttctgtttgagaccttcggg
tatcacttccggaacgaagactgcttcccctggcctggagcgccggtcctgcactgggag
ctgctgagcagggccctgctccacctgtgcatccatgccatcgggatccacctgttcatc
atgtcgcaggtgcggtcccggagcaccttcctgaaggtgggacagtccatcatgcacggc
aaagacctggaagtagaaaaagccctcaaagagaggatgattcattccgtgatgccgaga
atcatagcggacgacttgatgaagcagggggacgaggagagtgagaattctgtcaagagg
cacgccacctcgagccccaagaacaggaagaagaagtcctccatccagaaggctcccata
gcgttccgcccttttaagatgcagcagattgaggaagtcagcattttgtttgcagacatc
gtgggcttcaccaagatgagcgccaacaagtccgctcacgccctggtgggcctcctgaat
gatctgtttggccgcttcgaccggctgtgcgaggagaccaagtgtgagaagatcagcacc
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggcagaccatgcctac
tgctgtatagagatgggcttgggcatgatcaaagccatcgagcagttctgccaggagaag
aaagaaatggtaaacatgcgcgtcggggtccacacggggaccgtcctgtgtggcatcctg
ggcatgaggaggtttaagttcgacgtgtggtccaatgatgtgaatttggccaatctcatg
gagcagctgggagtggccggcaaagtccacatttccgaagccaccgcaaaatacctagac
gaccggtacgaaatggaagacgggaaagtgtttgagcgcctgggccagagcgtggtggct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcag
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcatcatcagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcatgtggaatcacctttgctcccaaa
gctgaagccggcgcagaaggcggcactgtccagaatggctgccaagatgagcctcagggc
ggcaccaaggcttctggaggacccagctccaaagctcagaatggactcctgagccctccc
cagcaggagaagctgaccaacagtcagacctccttgtgtgagatcctgcaggagaaagga
aggtgggcgggggtgagcttggaccagtcggctctgcttccgctgagattcaagaacatc
cgcgagaagaccgatgcccattttgtggacgttatcaaagaagacagcctgatgaaggat
tatttttttaagccacccatcaatcagttcagcctgaacttcctggacccggagctggag
cgatcctacagaaccagctatcaggaggaggtcataaagaactcccccgtgaagaccttc
gccagcgccaccttcagctcgctcctggacgtgttcttgtccacgacggtgttcctggtt
ctctccgccacctgcttcctgaagtatggggccgcggccacgcctcctccaccggccgcc
ctggcggtctttggggcagccctgctgctggaggtgctgtccctcgtggtgtccatcagg
atggtgttcttcctggaggacgtcatggcctgcacgaagcgtctgctggaatggatcgca
ggctggctgccgcgccactgcgtgggagccgtgctggtgtccctgcctgccctcgctgtc
tactcccatgtcacctcggaatttgagacaaacatacatttcccggtggtcacgggctcg
gcggtgctggtcgccgtggtgcactactgtaatttctgccagctcagctcctggatgagg
tcctccctggccaccatcgtgggggctgggccactgcttctgctctacatctcactgtgc
ccggacagtcccatagtagtgtcacccctggacgcagtacagaatttcagctccgggagg
agtccgtgcaatagctcgctgctgcaggacagcaagagaccagccagcctcgtgggcgag
gagctgatcctcgtcttcttcctcctgctcctgctggtctggttcctgaaccgagagttc
gaagtcagctaccgccttcactaccacggggacgtggaagcggatctgcaccgcaccaag
atccagagcatgcgggaccaggccgactggctgctgaggaacatcatcccctaccacgtg
gcggagcagctgaaggtatcccagacctactccaagaaccacgacagcggaggggtcatc
tttgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctcatcggggacttcgacgagctgctgagcaagccagac
tacagcagcatcgagaagatcaagaccatcggggccacgtacatggcggcttcggggctg
aacaccacgcagtgccaggacagcagccacccccaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgtgtggtggacgacttcaacaacaacatgctatggttcaac
ttcaagctcagagtcggctttaaccacgggcccctcacggcgggggtcatcggcaccact
aagctgctgtatgacatctggggggacaccgtcaacatcgccagcaggatggacaccaca
ggcgtcgagtgccgcatccaggtgagcgaagagagctaccgtgtcctgagcaagatgggc
tatgacttcgactacagagggacggtgaacgtcaaggggaagggccagatgaagacctac
ctttaccccaagtgcacggacaacggggtcgtgccgcaacaccagctgtccatctccccg
gacatccgcgtccaggtggatggcagcatcggacggtctcccacggacgagatcgccacc
ctggtgccttctgtccagtattcggacaagacgtccctgggctgcgagaacgcgcaggcc
agggacgcgcacccatcttccaagaggccctggaaagagcccatcaaagccgaagaaagg
tgtcggtttggcaaagccatagagaaagatgactgtgaagacgtggggctggaggaagcc
aacgaactcaccaagcttgacgtttccaagagcgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100343958
Entry
100343958         CDS       T03373                                 
Symbol
ADCY3
Name
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04740  Olfactory transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100343958 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100343958 (ADCY3)
   04371 Apelin signaling pathway
    100343958 (ADCY3)
   04020 Calcium signaling pathway
    100343958 (ADCY3)
   04072 Phospholipase D signaling pathway
    100343958 (ADCY3)
   04024 cAMP signaling pathway
    100343958 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100343958 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100343958 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100343958 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100343958 (ADCY3)
   04062 Chemokine signaling pathway
    100343958 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100343958 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100343958 (ADCY3)
   04912 GnRH signaling pathway
    100343958 (ADCY3)
   04913 Ovarian steroidogenesis
    100343958 (ADCY3)
   04915 Estrogen signaling pathway
    100343958 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100343958 (ADCY3)
   04921 Oxytocin signaling pathway
    100343958 (ADCY3)
   04926 Relaxin signaling pathway
    100343958 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100343958 (ADCY3)
   04918 Thyroid hormone synthesis
    100343958 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100343958 (ADCY3)
   04916 Melanogenesis
    100343958 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100343958 (ADCY3)
   04927 Cortisol synthesis and secretion
    100343958 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100343958 (ADCY3)
   04270 Vascular smooth muscle contraction
    100343958 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100343958 (ADCY3)
   04971 Gastric acid secretion
    100343958 (ADCY3)
   04972 Pancreatic secretion
    100343958 (ADCY3)
   04976 Bile secretion
    100343958 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100343958 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100343958 (ADCY3)
   04727 GABAergic synapse
    100343958 (ADCY3)
   04725 Cholinergic synapse
    100343958 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100343958 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100343958 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100343958 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100343958 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100343958 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100343958 (ADCY3)
   04714 Thermogenesis
    100343958 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343958 (ADCY3)
   05207 Chemical carcinogenesis - receptor activation
    100343958 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100343958 (ADCY3)
   05163 Human cytomegalovirus infection
    100343958 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100343958 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100343958 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100343958 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100343958 (ADCY3)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100343958 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 100343958
NCBI-ProteinID: XP_017196407
Ensembl: ENSOCUG00000015443
LinkDB
Position
2:complement(173931464..174007512)
AA seq 1144 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDADRGVGRTHEISVRNSGACLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVGFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLLLDLV
LFVVCKKGLLPDRLTRKAVPYLLWLLITAQIFSYLGLNFAQAHAASDTVGWQAFFLFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDELQGMQLLREILANIFLYLCVIIVG
VMSYYMADRKQRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVXXXXXXXVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASQPAVKAAAQNGLHGSALPNGAPASSKPSSPALIETKEPVGGSQAG
SSTWEEPEQQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLSMRFMDPDLESRYSEEKEKQSGAAFSCSCVVLLCTALVQILIDPWLMTNY
VTFVVGEVLLLILTVCSLAAIFPRAFPKKLVAFSTWIDQTRWARNTWAMLAIFILVMANV
VDMLSCLQDYAGPGNGTAGQELGGGCLENPKYYSYVAVLSLVATIMLVQVSHMVKLTLML
LVTGAVAAINLTAWSPVFDEYDHRRFQEHGFPLVALEKMQVVSAPGLNGTDRLPLMPSKY
SMTAMMLVMMLSFYYFSRHVEKLARTLFLWKMEVHDQKERVNEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAYPNGSSVTLPHQV
VDNP
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgcccaggaaccagggcttctcggagcccgagtactcggccgagtactccgccgagtac
tcggtcagcctgccgtcggatgcggaccgcggcgtgggccggacgcacgagatctccgtg
cggaactcgggcgcctgcctgtgtctgccccgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacctacttcaagcggcagcgccacgagaccctgctggtg
ctggtgggcttcgcggccctcttcgactgctacgtggtggtcatgtgcgccgtggtcttc
tcgagcgacaagctggcgccgctcgtcgtggctggcatcgggctgctgttggacctcgtg
ctcttcgtggtctgcaagaaggggctgctgcccgaccggctcacccggaaggcggtgccc
tacctgctgtggctgctgataacagcccagatcttctcctacctgggcctgaacttcgcg
caggcccacgcggccagcgacacggtgggctggcaggccttcttcctcttctccttcttc
atcacgctgccactcagcctcagccccatcgtcatcatctctgtggtctcctgtgtggtg
cacacgctcgtcctgggggtcactgtggcccagcagcagcaggacgagctgcaggggatg
cagctgctcagggagatcctggccaacatcttcctctacctgtgcgtcatcatcgtgggc
gtcatgtcctactacatggccgaccgcaagcagcgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaacctcatgctg
tccatcctgcccaagcacgtggccgatgagatgttgaaggacatgaagaaggatgagagc
cagaaagaccagcagcagttcaacaccatgtacatgtaccgccacgagaatgtnnnnnnn
nnnnnnnnnnnnnnngtgggcttcactcagctctcctctgcctgcagcgcccaggagctc
gtgaagctgctcaacgagctctttgcccgcttcgacaagctggcggccaaataccaccag
ctgcggatcaagatcctgggcgactgctactactgcatctgcgggctgcccgactaccgg
gaggaccacgccgtgtgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagactggcgtggacatgcgtgtgggggtgcacacaggcactgta
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggccggcggcatccccgggcgcgtgcacatctcccagagcacc
ctggactgcctgaagggagagttcgacgtggagcccggcgaggggggcagccgctgcgac
tacctggaggagaagggcatcgagacctacctcatcatcgcctcccagcccgccgtgaag
gccgccgcccagaacggcctccacggctcggccctgcccaacggagcgccagcttcctcc
aagcccagctcgcctgccctcattgagaccaaggagcccgtggggggcagccaggccggc
agttccacgtgggaggagcccgagcagcaggaggcgcaggcggacaacccctccttcccc
aaccctcgccggaggctgcgcctgcaggacctggccgaccgcgtggtggacgcctccgag
gacgagcacgagctcaaccagctgctcaacgaggccctgctggagcgcgagtccgcccag
gtggtgaagaagaggaacaccttcctcctgtccatgcggttcatggaccccgacctggag
tcccgctactcggaggagaaggagaagcagagcggggccgccttcagctgctcctgcgtc
gtcctgctgtgcacggccctggtgcagatcctcatcgacccctggctgatgacaaactac
gtgacctttgtggtcggggaggtcctgctcctgatcctgaccgtctgctcgctggctgcc
atctttccccgggcctttcctaagaagctggtagccttctccacgtggatcgaccagacc
cgctgggccaggaacacctgggccatgctggccatcttcatcctggtgatggcaaatgtc
gtggacatgctcagctgtctgcaggactacgcgggaccgggcaatggcacggcggggcag
gagctggggggcggctgcctggagaaccccaagtattacagctacgtggccgtgctgtcg
ctcgtcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatgctg
ctcgtcacgggcgccgtggccgccatcaacctcaccgcctggagccccgtcttcgacgag
tacgaccacaggcgcttccaggagcacggcttccccctggtggccctggagaagatgcag
gtcgtttccgcccctgggctcaacggtaccgacaggctgccgctgatgccatccaagtac
tcgatgacagcgatgatgctggtcatgatgctgagcttttactacttctcgcgccacgtg
gaaaagctggcacggaccctgttcctgtggaagatggaggtccacgatcagaaggagcgt
gtcaatgagatgcggcgctggaacgaggccttggtcaccaacatgctgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagacgaggagctgtacagccagtcctatgat
gagatcggagtcatgttcgcctccctgcccaacttcgccgacttctacaccgaggagagc
atcaacaatgggggcatcgagtgcctgcgcttcctcaacgagatcatctccgactttgac
tctctcctggacaatcccaaatttcgggtcatcacgaagatcaaaaccattggcagcacc
tatatggcggcttcgggagtcaccccagatgtcaacaccaacggctttaccagctccaac
aaggaagagaagtcagacaaggagcgctggcagcacctggccgacctggccgacttcgca
ctcgccatgaaggacacgctgaccaacatcaacaatcagtccttcaacaacttcatgctg
cgcataggcatgaacaaaggaggggttctggctggcgtcatcggagcccggaaaccacac
tatgacatctggggcaacactgtcaatgtggccagcagaatggagtccacaggggtcatg
ggcaacattcaggtggtggaggaaacgcaagtgatcctgagagagtacggcttccgcttc
gtgaggcgcggccccatctttgtgaaaggaaagggggaactgctgaccttcttcctgaag
gggcgggacaagcccgctgcctaccccaacggctcctcggtgaccctgccccaccaggtg
gtcgacaacccctga

KEGG   Oryctolagus cuniculus (rabbit): 100346742
Entry
100346742         CDS       T03373                                 
Symbol
ADCY4
Name
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100346742 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100346742 (ADCY4)
   04371 Apelin signaling pathway
    100346742 (ADCY4)
   04020 Calcium signaling pathway
    100346742 (ADCY4)
   04072 Phospholipase D signaling pathway
    100346742 (ADCY4)
   04024 cAMP signaling pathway
    100346742 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100346742 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100346742 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100346742 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100346742 (ADCY4)
   04062 Chemokine signaling pathway
    100346742 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100346742 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100346742 (ADCY4)
   04912 GnRH signaling pathway
    100346742 (ADCY4)
   04913 Ovarian steroidogenesis
    100346742 (ADCY4)
   04915 Estrogen signaling pathway
    100346742 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100346742 (ADCY4)
   04921 Oxytocin signaling pathway
    100346742 (ADCY4)
   04926 Relaxin signaling pathway
    100346742 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100346742 (ADCY4)
   04918 Thyroid hormone synthesis
    100346742 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100346742 (ADCY4)
   04916 Melanogenesis
    100346742 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100346742 (ADCY4)
   04927 Cortisol synthesis and secretion
    100346742 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100346742 (ADCY4)
   04270 Vascular smooth muscle contraction
    100346742 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100346742 (ADCY4)
   04971 Gastric acid secretion
    100346742 (ADCY4)
   04972 Pancreatic secretion
    100346742 (ADCY4)
   04976 Bile secretion
    100346742 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100346742 (ADCY4)
   04727 GABAergic synapse
    100346742 (ADCY4)
   04725 Cholinergic synapse
    100346742 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100346742 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100346742 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100346742 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100346742 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100346742 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100346742 (ADCY4)
   04714 Thermogenesis
    100346742 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346742 (ADCY4)
   05207 Chemical carcinogenesis - receptor activation
    100346742 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346742 (ADCY4)
   05163 Human cytomegalovirus infection
    100346742 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100346742 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100346742 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100346742 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100346742 (ADCY4)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100346742 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom AC_N CD52
Other DBs
NCBI-GeneID: 100346742
NCBI-ProteinID: XP_008267668
Ensembl: ENSOCUG00000002958
LinkDB
Position
17:complement(44361239..44377008)
AA seq 1086 aa
MARLFSPRPPPSDDLFYETYYSLSQQYPLLLLLLGIVLCALVALLGVAWASGRELISDPS
FLSTVLCALGGFSLLLGLASREQRLQRWTRALSGLVWAALLALGHGFLFTGGVVSAWNQV
SFFLFVIFTAYAMLPLGMRDAVAAGLASSLSHLLVLGLYLGPQPDSQPALLPQLAANAVL
FVCGNAVGAYHKALMERALRATFREALSSLQSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPVSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGHELLRPSLLMT
RYLESWGAAKPFAHLSHIDSPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDA
KFFQVIEQLNSQKQWRQSKDFSPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNF
IIQMLVTDRPPALAITYSITFLLFFLLLFVCFSEHLTKCVLKGPKMLHWLPTLSGLVATR
PGLRVALGTATILLVFIMAITSLFFLPASLDCPPWAPNVSSIAFNLSWQLPGSLPLLSVP
YSMHCCVLGSLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYVGPLD
SRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETEMMENLTR
LLLENVLPAHVAPQFIGQKRRNEDLYHQSYECVCVLFASIPDFKEFYSESNINHEGLECL
RLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQVQQQAHCQDAER
SCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTV
NVASRMESTGVLGKIQVTEETAQALQSLGYTCCIRGIIKVKGKGQLRTYFLNTDLTRTGP
PSATLG
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcgcgcctcttcagcccccggccgcctcccagcgacgacctcttttacgagacctac
tacagcttgagccaacagtacccgctactgctgctgctgctggggatcgtgctgtgcgcg
ctcgtggcgctgctcggcgtcgcctgggccagcggcagggagctgatctcagacccgagc
ttcctaagcaccgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctggcttcc
cgcgagcagcgacttcagcgctggacgcgcgccctgtccggcctcgtgtgggccgcgctg
ctagcgctcggccacggcttcctgttcacagggggcgtggtgagcgcctggaaccaggtg
tcctttttcctcttcgtcatcttcacggcgtatgccatgctgcccttggggatgcgggac
gcggtcgctgcaggcctggcctcttcactctcgcacctgctggtcctggggctgtacctt
gggccacagcctgattcgcagccggcgctgctgccgcagcttgcagccaacgcagtgctg
ttcgtgtgtgggaacgcggtgggggcgtaccacaaagcgctgatggagcgtgccctgcgc
gccaccttccgcgaggcgctcagctccctgcagtcgcgccggcggctggacaccgagaag
aagcaccaggaacacctgctgttgtccatccttcctgcctacctggccagggagatgaag
gcagagatcatggctcggctgcaggctggacaggggtcccggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcaccaggctggccagcgagtgctcccccaaggagctggtgctcatgctcaacgag
ctctttggaaaattcgaccagatcgccaaggagcacgaatgcatgcggatcaagatccta
ggggactgctactactgtgtctccgggcttccagtctccctgccagaccatgccatcaac
tgcgtacgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggt
gtagatatcaacatgcgtgtgggcgtgcactcgggcagcgtgctctgcggagtcatcggc
ctgcagaagtggcagtacgatgtctggtcccatgacgtcacactggccaaccacatggag
gcaggcggcgtgccaggacgagtgcacatcacgggggccacgctggctctgctggccggg
gcttacgcagtggaggacgcagccatggaacaccgggacccgtaccttcgagagctaggg
gagccgacctacctggtcattgatccccgggccgaggaggaggacgagaagggcacagca
ggagggctgctgtcctctctcgagggccacgagctgctgcgtccgtctctgctgatgacc
cgctacctggagtcgtggggtgcagccaagccttttgcccacctgagccacatagacagc
cctgtgtccacctccacccctctcccggagaaggccttggcttccttcagcccccagtgg
agcctggaccggagccgtaccccccggggcctagacgatgagctggacaccggggatgcc
aagtttttccaggtcatcgaacagctcaactctcagaaacaatggaggcagtcgaaggac
ttcagcccactgacgctctacttcagagagaaggagatggagaaggagtaccgtctctcc
gcactccctgccttcaagtactatgcagcctgcaccttcctggtttttctctccaacttc
atcatccagatgctggtgacagacaggcccccagctctggccatcacctacagcatcacc
ttcctcctcttcttcctcctgctcttcgtctgcttctcagagcacctgacgaagtgtgtc
ctgaagggccccaagatgctgcactggctgcccacactgtccggcctggtagccacacgc
cctggactgcgagtggccctgggcactgccaccatcctcctcgtcttcatcatggccatt
accagcctgttcttcctaccagcatcgctggactgtccaccctgggctcccaatgtgtcc
tccattgctttcaacctctcctggcagctccctgggtccctgcccctcctcagtgtccca
tactccatgcactgctgcgtgctgggctccctgtcctgctccctctttctgcacatgagc
ttcgaactcaagctgctgctgctgctgctctggctcgtggcctcctgctccctcttcctg
cactcccacgcctggctgtccgactgcctcatcgcccgcctctacgtgggacccttggac
tccaggccgggcgtgctgaaggagcccaagctgatgggagccatctccttcttcatcttc
ttcttcaccctccttgtcctggctcgacagaatgagtattactgccgcctggacttcctg
tggaagaagaagctgaggcaagagcgcgaggagacagagatgatggagaatctgacccgg
ctgctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaacgg
cgcaacgaggacctctaccaccagtcctacgagtgtgtttgtgtcctcttcgcctccatc
ccagactttaaggagttctactcggaatccaacatcaaccacgaagggctcgagtgtttg
cggctactcaatgagatcattgctgatttcgatgagctgctctccaagcccaagttcagc
ggggtggagaagatcaaaaccatcggcagcacctacatggcagccacaggcttaaacgcc
acctctggccaggatgcccaacaggtccagcaacaggcccactgccaggatgctgagcga
agctgcagccaccttggcaccatggtggaatttgcagtggccctggggtccaagctagac
gtcatcaacaagcactcgttcaacaacttccgcctgcgtgtggggctgaaccacggacca
gtagtggctggagtcattggggcccagaagccacaatatgacatctggggcaacacggtg
aatgtggccagccgcatggagagcaccggagtcctgggcaaaatccaggtgactgaggag
acagcccaggccctgcagtcgctgggctacacctgctgcattcggggcatcatcaaggtc
aaaggcaaagggcagctgcgcacctacttcctgaacacggacttgacgcgaactgggcct
ccctcagccaccctgggctga

KEGG   Oryctolagus cuniculus (rabbit): 100354934
Entry
100354934         CDS       T03373                                 
Symbol
ADCY6
Name
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04962  Vasopressin-regulated water reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100354934 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100354934 (ADCY6)
   04371 Apelin signaling pathway
    100354934 (ADCY6)
   04072 Phospholipase D signaling pathway
    100354934 (ADCY6)
   04024 cAMP signaling pathway
    100354934 (ADCY6)
   04022 cGMP-PKG signaling pathway
    100354934 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100354934 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100354934 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100354934 (ADCY6)
   04062 Chemokine signaling pathway
    100354934 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    100354934 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    100354934 (ADCY6)
   04912 GnRH signaling pathway
    100354934 (ADCY6)
   04913 Ovarian steroidogenesis
    100354934 (ADCY6)
   04915 Estrogen signaling pathway
    100354934 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100354934 (ADCY6)
   04921 Oxytocin signaling pathway
    100354934 (ADCY6)
   04926 Relaxin signaling pathway
    100354934 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    100354934 (ADCY6)
   04918 Thyroid hormone synthesis
    100354934 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    100354934 (ADCY6)
   04916 Melanogenesis
    100354934 (ADCY6)
   04924 Renin secretion
    100354934 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100354934 (ADCY6)
   04927 Cortisol synthesis and secretion
    100354934 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100354934 (ADCY6)
   04270 Vascular smooth muscle contraction
    100354934 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    100354934 (ADCY6)
   04971 Gastric acid secretion
    100354934 (ADCY6)
   04972 Pancreatic secretion
    100354934 (ADCY6)
   04976 Bile secretion
    100354934 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100354934 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100354934 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    100354934 (ADCY6)
   04727 GABAergic synapse
    100354934 (ADCY6)
   04725 Cholinergic synapse
    100354934 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100354934 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    100354934 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100354934 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    100354934 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100354934 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100354934 (ADCY6)
   04714 Thermogenesis
    100354934 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354934 (ADCY6)
   05207 Chemical carcinogenesis - receptor activation
    100354934 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100354934 (ADCY6)
   05163 Human cytomegalovirus infection
    100354934 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    100354934 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100354934 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100354934 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100354934 (ADCY6)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100354934 (ADCY6)
SSDB
Motif
Pfam: Guanylate_cyc AC_N Adcy_cons_dom HNOBA TBK1_ULD GBR2_CC
Other DBs
NCBI-GeneID: 100354934
NCBI-ProteinID: XP_017197314
Ensembl: ENSOCUG00000007394
UniProt: G1SSZ0
LinkDB
Position
4:complement(33095161..33114188)
AA seq 1164 aa
MSWFSGLLVPKVDERKTAWGERNGQQRLRRGTRAAGFCAPRYMSCLQDAEPPSPTPAAPR
RCPWQDEAFIRRGGPGPGKGVELGLRAVALGFEDAELTAATGVTEVAPRRGRSCWRRLAQ
VFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLAFHAVPGSPQPAYVALL
AGAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPHSPSAGLWCPMF
FVYITYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDALLWKQLGANVLLFLCTNLIGI
CTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKED
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIK
ILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGV
LGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKE
QHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRTFSRTKDSKAFRQMGI
DDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRK
VDPRFGAYVACALLVFCFICFIQLLVFPHSTLMLGIYAGIFLFLLVTVLTCAVYSCGSRF
PRVLQRLSRGIVRSRAHSTAVGIFSVLLVFTSAIANMFNCSHTPIRMCVAQMLNLTPSDV
TACHLQQLNYSLDLDAPLCEGTTPPCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMILV
LGLIYLVLLLLGPPATIFDNYDLLLSVHGLASSNETLDGLDCPAAGRVALKYMTPVILLV
FALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARE
RRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEQF
RQLEKIKTIGSTYMAASGLNASTYDQVGRSHVTALADYAMRLMEQMKHINEHSFNNFQMK
IGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLE
CRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgtcctggtttagcggtctcctggttcccaaagtggatgagcggaaaacagcctggggc
gaacgcaatgggcagcagcgcctgcgccgtgggactcgggccgccggcttctgcgcacct
cgctatatgagctgcctccaggatgcagagccacccagccctaccccagccgctccccgg
aggtgcccctggcaggatgaggccttcatccgcagggggggcccgggcccggggaagggc
gtggagctggggctgcgggcagtggccctgggcttcgaggacgcggagctgacggcagcg
acgggggtgactgaggtggcaccgcggcgcgggcgatcgtgctggcgccgcctggcgcag
gtgttccagtccaagcagttccgctcggccaagctggagcgcctataccagcgctacttc
ttccagatgaaccagagcagcctcacgctgctgatggcggtgctggtgctgctcatggct
gtgctgctggctttccacgctgtgcctggcagccctcagcctgcctacgtggccctgttg
gctggggccgccaccctgttcgtagcgctcatggtggtgtgtaatcggcatagcttccgc
caggactccatgtgggtggtgagctacgtggtgctgggcatcctggctgccgtgcaggtc
gggggcgccctggcagccgacccgcacagcccgtctgcgggcctctggtgccccatgttc
ttcgtctacatcacctacaccctcctgcccatccgaatgcgggctgccgttctcagcggc
cttggcctttccactctgcatttgatcttagcttggcaactcaaccgtggcgatgccttg
ctttggaagcagcttggtgccaacgtgctgctgttcctctgcaccaacctcattggtatc
tgcacacactacccagccgaggtgtctcagcgccaggcttttcaggagacccgtggttac
atccaggcccggctgcacctgcagcacgagaaccggcagcaggagcggctgctgctgtcc
gtgttgccccagcatgttgccatggagatgaaagaagacattaacacaaaaaaggaagac
atgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctgtttgccgac
atcgagggctttaccagcctggcctcccagtgcaccgcacaggagctggtcatgactttg
aatgagctctttgcccggtttgacaaactggccgcggagaatcactgcctgaggatcaag
atcttaggggactgttactactgtgtgtcagggctgccagaggcccgggcagaccatgcc
cactgctgtgtggagatgggggtggacatgatcgaggccatctcgctagtgcgtgaggtg
acaggtgtgaatgtgaacatgcgcgtgggtatccacagtggtcgtgtgcactgcggtgtc
cttggcctgcggaagtggcagttcgatgtgtggtccaacgacgtgaccctggccaaccac
atggaggccgggggccgggccggccgcatccacatcactcgggccacactgcagtacctg
aacggggactacgaggtggagcctggccgtggtggtgagcgcaatgcatacctcaaggag
cagcacatagagaccttcctcatcctgggtgccagccagaaacggaaagaggaaaaggcc
atgctggctaagctacagcggacgcgggccaattccatggagggtctgatgccacgctgg
gtgcctgaccgcactttctcccgcaccaaggattccaaggccttccgccagatgggcatt
gatgattccagcaaagacaaccggggtgcccaggatgctctgaaccctgaggatgaggta
gatgaattcctgggccgtgccatcgatgcccgcagcatcgatcagctgcgcaaggaccac
gtgcgccggttcctgctcaccttccagagagaggatctagagaagaagtactcgcggaag
gtggacccccgctttggagcctacgtcgcctgtgccctgctcgtcttctgcttcatttgc
ttcatccagctcctcgtcttcccccattcaaccctgatgctcgggatctatgccggtatc
ttcctgttcctgctggtcactgtgctcacctgtgccgtgtactcctgtggttctcggttc
cccagggtgctgcagcgcctgtctcgcggcattgtccgctcgcgggcacacagcacagca
gttggcatcttttcagtcttgcttgtgtttacctccgccatcgccaacatgttcaactgc
agccacacccccatacggatgtgcgtggcccagatgctgaatttaactccctccgacgtt
actgcttgccacctgcagcagctcaattactctctggacctggatgcgcccctgtgtgag
ggcaccacacccccctgcagcttccctgagtacttcgttgggaacatgctgctgagtctc
ctggccagctctgtcttcctgcacatcagcagcatcgggaagctggccatgatcttagtc
ttggggctcatctatctggtgctgcttcttctgggtcccccagccaccatctttgacaac
tatgacctgctgcttagcgtccatggcttggcttcttctaatgagaccttggatgggctg
gactgcccagctgcagggagggtggccctcaaatacatgacccctgtgatcctgctggtg
tttgcgctggcactgtatctgcatgcccagcaggtggagtctacagctcgtctggacttc
ctctggaaactgcaggcaacaggggagaaggaggagatggaggagctccaggcgtacaac
cggcggctgctgcataacattctccccaaggatgtggctgcccacttcctggccagggag
cgccggaatgatgagctctactaccagtcgtgtgagtgtgtggccgtgatgtttgcctcc
atcgccaacttctctgagttctacgtggagctggaggccaacaatgagggcgtcgagtgc
ctgcggctgctcaacgagatcatcgctgactttgacgagatcatcagcgaggagcagttc
cggcagctggagaagatcaagactataggcagcacctacatggctgcctcggggctgaat
gccagcacctatgaccaggtgggccgctcccacgtcaccgccctggctgactacgccatg
cggctcatggagcagatgaagcacatcaatgagcactccttcaacaacttccagatgaag
atcgggctgaacatgggcccagttgtggccggtgtcattggggcccggaagccgcagtat
gacatctgggggaacacggtgaatgtctctagccgtatggacagcacaggggtccctgac
cgaatccaggtgaccacggacctgtaccaggttctagctgccaagggctaccagctggag
tgtcgaggggtggtcaaggtgaagggcaaaggggagatgaccacctacttcctcaatggg
ggccctagcagttag

KEGG   Oryctolagus cuniculus (rabbit): 100357357
Entry
100357357         CDS       T03373                                 
Symbol
ADCY7
Name
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100357357 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100357357 (ADCY7)
   04371 Apelin signaling pathway
    100357357 (ADCY7)
   04020 Calcium signaling pathway
    100357357 (ADCY7)
   04072 Phospholipase D signaling pathway
    100357357 (ADCY7)
   04024 cAMP signaling pathway
    100357357 (ADCY7)
   04022 cGMP-PKG signaling pathway
    100357357 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100357357 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100357357 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100357357 (ADCY7)
   04062 Chemokine signaling pathway
    100357357 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    100357357 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    100357357 (ADCY7)
   04912 GnRH signaling pathway
    100357357 (ADCY7)
   04913 Ovarian steroidogenesis
    100357357 (ADCY7)
   04915 Estrogen signaling pathway
    100357357 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    100357357 (ADCY7)
   04921 Oxytocin signaling pathway
    100357357 (ADCY7)
   04926 Relaxin signaling pathway
    100357357 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    100357357 (ADCY7)
   04918 Thyroid hormone synthesis
    100357357 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    100357357 (ADCY7)
   04916 Melanogenesis
    100357357 (ADCY7)
   04925 Aldosterone synthesis and secretion
    100357357 (ADCY7)
   04927 Cortisol synthesis and secretion
    100357357 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100357357 (ADCY7)
   04270 Vascular smooth muscle contraction
    100357357 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    100357357 (ADCY7)
   04971 Gastric acid secretion
    100357357 (ADCY7)
   04972 Pancreatic secretion
    100357357 (ADCY7)
   04976 Bile secretion
    100357357 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    100357357 (ADCY7)
   04727 GABAergic synapse
    100357357 (ADCY7)
   04725 Cholinergic synapse
    100357357 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    100357357 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100357357 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    100357357 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    100357357 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100357357 (ADCY7)
   04714 Thermogenesis
    100357357 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357357 (ADCY7)
   05207 Chemical carcinogenesis - receptor activation
    100357357 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357357 (ADCY7)
   05163 Human cytomegalovirus infection
    100357357 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    100357357 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100357357 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100357357 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100357357 (ADCY7)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100357357 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc Adcy_cons_dom AC_N
Other DBs
NCBI-GeneID: 100357357
NCBI-ProteinID: XP_008273270
Ensembl: ENSOCUG00000003091
UniProt: G1SJ05
LinkDB
Position
Un
AA seq 1080 aa
MPAKGRYFLNEGEEGPDQAALYEKYRLTSQHGPLLLTLLVAATAACCALIAIAFSHGDPS
QHQAVLATAFLALAVFVAVYVLVYVECLVRRWLRAVALLTWACLLTLGYVLVFDSRTKQA
CAWEQVPFFLFIIFVVYTLLPFSTQGAVAVGVVSTASHLLVIGAVMGVFTTPSAQVGLQL
LANAVIFLCGNFTGAFHKHQLQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRYLPDNNFHSLYVKRHRNVSILYADIVGFTRLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LSHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQQLPRPRGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPSGRRPKAIPLRRHRTPDRSASPRGRA
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKDFEREYRLAPVPRARYDFACA
GLIFVCILLVHLLVMPRTVALGVSFGLVACVLALVLGLCFATELLRGCLAPGTRRAISER
VETQPLLRLTLAVLTIGSLLTVAVINLPLMPLPALGLPGGNETSPETLSGKDATLCAVLP
YYTCTCILGFVACSVFLRMSLELKLVLLTVALVAYLLLFNLSPCWQWDCCGSGLGNLTTG
NGTLSSTPTCSWRDLNTMINFYLVLFYGTLVMLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVTPGHENQDLERQHTH
IGVMVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQALGYSCECRGLINVKGKGELRTYFVCTDTAKCQGLGLN
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgccggccaaggggcgctacttcctcaacgagggcgaggagggcccggaccaggcggcg
ctctatgagaagtaccggctcaccagccagcacgggccgctgctgctcaccctgctggtg
gccgccaccgccgcctgctgcgccctcatcgccatcgccttcagccatggggacccctct
cagcaccaggctgtgctggccacggcgttcctggcgctcgccgtgtttgtggctgtctac
gtgctggtgtacgtcgagtgccttgttcggcgctggctcagggcggtggcgctgctcacc
tgggcctgcctgctgacgctgggctatgtgctggtgttcgactcgcggacgaagcaggcc
tgtgcgtgggagcaggtgcccttcttcttgttcatcatcttcgtggtgtacacgctgctg
cccttcagcacgcagggagctgtggccgtgggggtcgtctccaccgcctcccacctgttg
gtgatcggcgccgtgatgggggtcttcaccacgcccagcgcccaggtggggctacagctg
ctggccaatgctgtcatcttcctgtgcggcaacttcacgggcgccttccacaagcaccag
ctgcaggatgcctcccgcgacctcttcacctacacggtcaagtgcatccagatccgccgg
aagctgcgcattgagaagcgtcagcaggagaacctgctgctgtctgtgctgccggcgcac
atctccatgggcatgaagctggccatcatcgagcggctcaaggagcacggggaccgccgc
tacctgcccgacaacaacttccacagcctctacgtcaagcggcaccggaacgtcagcatc
ctctacgcggacatcgtgggcttcacgcgcctggccagcgactgctcccccaaggagctg
gtggtggtgctcaacgagcttttcggcaagtttgaccagatcgccaaggccaacgagtgc
atgcggatcaagatcctgggtgactgctactactgcgtgtcgggcttgcccgtgtccctg
cctacccacgcccggaactgtgtgaagatggggctggacatgtgtgaggccattaagcag
gtgcgggaggccacgggcgtggacatcagcatgcgtgtgggcatacactcggggaacgtg
ctgtgtggcgtcatcgggctgcgcaagtggcagtacgacgtgtggtcccacgacgtgtcg
ctggccaacaggatggaggcggctggagtccccggccgggtgcacatcacagaggcgacg
ctgagccacctggacaaggcgtacgaggtggaggacgggcacgggcagcagcgtgacccc
tacctgaaggagatgaacatccgcacctacctggtcattgacccccggagccagcagccg
cccccacccagccaacagctgcccaggccccggggggatgcggccctgaagatgcgggcg
tccgtgcgcatgacccgctacttggagtcctggggggcggcgcggcccttcgcacacctc
aaccaccgcgagagcgtgagcagcggcgagacccccgtccccagtggccggaggcccaag
gccattcccctacggcgccaccggacccctgacaggagcgcatcccccagggggcgggcg
gaggacgactcctatgatgacgagatgctgtcagccatcgaggggctcagctccaccagg
ccctgctgctccaagtctgacgacttctacacctttgggtccatcttcctggagaaggac
tttgaacgagagtaccgcctggcgcctgtgccccgtgcccgctacgactttgcctgcgct
ggcctcatctttgtctgcatcctgctagtccacctcctggtgatgcccaggacggtggcc
ctgggtgtgtcctttgggctggtggcctgcgtgctggcgctggtgctaggcctgtgcttt
gccacagagctcttgaggggctgcctggcccccgggacgcgccgggccatctcggagcgg
gtggagacgcagcccctgctgaggctgaccctggccgtgctcaccatcggcagcctgctc
actgtggccgtcatcaacctgcccctgatgcctctcccagccttggggctgcctggtggc
aacgagacgagcccagagaccttgagcggcaaggatgcgaccctgtgtgcggtcctcccg
tattacacctgcacttgcatcctgggcttcgtggcttgctcggtcttcctgcggatgagc
ctggagctgaagttggtgctgctgacagtggccctggtggcctacctgctgctcttcaac
ctctccccctgctggcagtgggactgctgcggctcgggcctgggcaacctcaccacgggc
aatggcaccctcagcagcacccccacctgttcctggagggatctgaataccatgatcaac
ttctacctggtcctgttttacggcaccctggtcatgctctccagacagatcgactactac
tgccgcctggactgtctgtggaagaagaagttcaagaaggagcacgaggagtttgaaacc
atggagaacgtgaaccgcctgctcctggagaacgtgctgccagcccacgtggccgcccac
ttcattggggacaaactcaacgaggactggtaccatcagtcctacgactgcgtctgcgtc
atgtttgcctccgtgccggacttcaaggtgttctacaccgagtgcgacgtcaacaaggag
gggctggagtgtctgcggctgctcaacgagatcatcgccgacttcgatgagctgctgctg
aagcccaagttcagcggcgtggagaagatcaagactatcggcagcacgtacatggcggct
gcggggctcagcgtcaccccagggcacgagaaccaggacctggagcggcagcacacccac
atcggcgtcatggtggagttcagcatggccctgatgagcaagctggatggcatcaaccgg
cactccttcaactccttccgcctgcgagtcggcataaaccacgggccggtgattgctgga
gtgattggggctcggaaacctcagtatgacatctggggaaacacagtcaatgttgccagc
cgaatggagagcaccggagaactcggcaaaatccaggtgacagaagagacctgcaccatc
ctccaggcactgggctactcctgcgaatgccggggactgatcaatgtcaaaggcaaaggc
gaactgaggacttactttgtctgtacagacactgccaagtgtcaagggctggggctcaac
tga

DBGET integrated database retrieval system