KEGG   Oryctolagus cuniculus (rabbit): 100009220
Entry
100009220         CDS       T03373                                 
Symbol
ROCK1, ROCK-I
Name
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu05135  Yersinia infection
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100009220 (ROCK1)
   04071 Sphingolipid signaling pathway
    100009220 (ROCK1)
   04024 cAMP signaling pathway
    100009220 (ROCK1)
   04022 cGMP-PKG signaling pathway
    100009220 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009220 (ROCK1)
   04530 Tight junction
    100009220 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009220 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009220 (ROCK1)
   04670 Leukocyte transendothelial migration
    100009220 (ROCK1)
   04062 Chemokine signaling pathway
    100009220 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100009220 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100009220 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100009220 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009220 (ROCK1)
   05206 MicroRNAs in cancer
    100009220 (ROCK1)
   05205 Proteoglycans in cancer
    100009220 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100009220 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100009220 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009220 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100009220 (ROCK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100009220 (ROCK1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100009220 (ROCK1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    100009220 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil APH Pkinase_C
Other DBs
NCBI-GeneID: 100009220
NCBI-ProteinID: NP_001075836
Ensembl: ENSOCUG00000004848
UniProt: O77819
LinkDB
Position
9:complement(62280338..62423163)
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSPANPNDNRTSSNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKYNLERMEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHAVSRLEETNSILTKDIELLRKENE
ELTDKMRKSEEEYKLQKEEEISNLKATYEKNINTERTLKTQAVNKLAEIMNRKDFKIDKK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLSDLSDSTSVASFPSADETDPNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEVEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cctaaatcggaagtgaactcggattgtttgctggatggattggatgctttggtgtatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gatacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtagtgaaa
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccagaaag
gtatatgctatgaagcttctcagcaagtttgaaatgattaagagatctgattctgcattt
ttctgggaagaaagagacatcatggcttttgctaacagtccttgggttgttcagcttttt
tatgcattccaagacgatcgttatctgtacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgcttctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgacaacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggacgagaatgtgac
tggtggtcagttggagtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctctggttgggacttacagtaaaattatgaatcataaaaattcacttaccttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaagtgcgattagggcgaaatggtgtagaagaaatcaaacgacatcttttcttcaaaaat
gaccagtgggcttgggaaacactccgagacactgtagcaccagttgtacctgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagatgaagaaaca
ttccctattcctaaagcttttgttggcaatcagctaccttttgtaggatttacatactat
agtaatcgtagatacttatctccagcaaatcctaatgataacagaactagctccaatgtg
gataaaagtttgcaggaaaatttgcaaaaaactatctacaagctggaagaacagctgcat
aatgaaatgcaattaaaagatgaaatggaacagaagtgcagaacttcaaacataaaacta
gacaagataatgaaagaattggatgaagaggggaatcaaagaagaaatctagaatctaca
gtgtctcaaattgagaaggagaaaatgttactacagcatagaattaatgagtaccaaaga
aaggctgaacaggaaaatgagaagaggagaaatgtagaaaatgaagtttctactttaaag
gaccaattagaagacttaaagaaagtaagtcagaattcacagcttgctaatgagaagcta
gcacaattacaaaagcagctagaagaagccaatgacttacttaggacagaatcggacaca
gctgtaagattaaggaagagtcatacggagatgagcaaatcaattagtcagctagagtcc
ctcaacagagaattgcaagagagaaacagaattttagagaattccaagtcacaaacagat
aaggattattaccagctgcaagctgtattagaagctgaacgaagagacagaggtcatgat
tctgagatgattggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaatacaatcttgaaagaatggaaggagaaagaaaagaggctcaagatatgcttaat
cattcagaaaaggaaaaaaataatttagagatagatctaaactataagcttaaatcatta
caacaacgcttagaacaagaggtgaatgaacacaaagtaacgaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgttgcaatgtgtgagatggaaaaaaagttg
aaagaagagagagaagctcgagagaaggctgaaaatagggttgttcagattgagaagcag
tgttccatgctggatgtggatctgaagcaatctcagcagaagctggagcatttgacggaa
aacaaagaaaggatggaggatgaagttaagaatctaactctacagctggaacaggaatca
aataagcgactgttgttacaaaatgagttgaagacccaagcatttgaggcagataattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcgaagagatta
ttagaatttgagttagctcagcttacaaagcaatatagaggaaatgaaggacaaatgagg
gagctacaagatcagcttgaagctgagcagtatttttcgacactttataaaactcaggta
aaggaacttaaagaagaaattgaagaaaagaacagagaaaatttaaagaagatacaagaa
ctacaaaatgaaaaggaaactcttgctactcagttggatctcgcagagacgaaagctgag
tctgagcagttggctcgagggcttctagaagaacagtattttgaattgacccaagaaagc
aagaaagctgcttcaagaaatagacaggagattacagataaagatcatgctgttagtcgg
cttgaagaaacaaacagcatcctaaccaaagatattgaattgttaagaaaagaaaatgaa
gagctaactgataaaatgaggaagtcagaagaagaatataaattacagaaagaggaggaa
atcagtaatcttaaggctacctatgaaaagaatatcaatacggaacgaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgcaaagattttaaaattgataaaaag
aaggctaatacacaagatttaagaaaaaaagaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagaaaaattcaaccagatggtagtaaaacatcagaaagaactgaat
gacatgcaagcgcaattggtagaagaatgtacacataggaatgaacttcaaatgcaattg
gctagcaaagagagtgatattgagcagttgcgtgctaagctttcggacctttcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatccaaatcttccagagtcaaga
attgaaggttggctttctgttccaaatagaggaaatattaagcgatatggctggaaaaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataacgatgaacaagataaggaa
caatctaatccttctatggtactggacatagataaattgtttcatgttcgacctgtaact
caaggagatgtatacagagctgagactgaagaaattcctaaaatattccagatactgtat
gcaaatgaaggcgaatgtagaaaagatgtagaggtagaaccagtacaacaagctgaaaaa
accaatttccagaatcacaaaggccatgaattcattcctacactgtaccactttcccgcc
aactgtgaggcctgtgccaaacctctctggcatgtctttaagccaccccctgccctagaa
tgtcgaagatgccatgttaagtgccacagagatcacttagacaagaaagaggacttaatc
tcgccatgtaaagtaagttatgatgtgacatcagcaagagatatgctgctgttagcctgc
tctcaggatgaacaaaaaaaatgggtaactcatttagtgaagaagatccctaagaatcca
ccatctggttttgttcgtgcctcccctcgaacgctttctactagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

KEGG   Oryctolagus cuniculus (rabbit): 100346837
Entry
100346837         CDS       T03373                                 
Symbol
ROCK2
Name
(RefSeq) Rho associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04270  Vascular smooth muscle contraction
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04510  Focal adhesion
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu04921  Oxytocin signaling pathway
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100346837 (ROCK2)
   04071 Sphingolipid signaling pathway
    100346837 (ROCK2)
   04024 cAMP signaling pathway
    100346837 (ROCK2)
   04022 cGMP-PKG signaling pathway
    100346837 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100346837 (ROCK2)
   04530 Tight junction
    100346837 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100346837 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100346837 (ROCK2)
   04670 Leukocyte transendothelial migration
    100346837 (ROCK2)
   04062 Chemokine signaling pathway
    100346837 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100346837 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100346837 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    100346837 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346837 (ROCK2)
   05205 Proteoglycans in cancer
    100346837 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100346837 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100346837 (ROCK2)
   05135 Yersinia infection
    100346837 (ROCK2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100346837 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100346837 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100346837 (ROCK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100346837 (ROCK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100346837 (ROCK2)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    100346837 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 100346837
NCBI-ProteinID: XP_008248064
Ensembl: ENSOCUG00000017477
LinkDB
Position
Un
AA seq 1391 aa
MKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAF
ANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIH
SMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQG
GDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAK
NLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDD
IEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCRENDSVQSRKNEESQEIQ
KKLYTLEEHLSNELQAKEELEQKCKSVNSRLEKTAKELEEEITLRKTVESALRQLEREKA
LLQHKNAEYQRRAEHEADRKRNLENDVNSLKDQLEDLKRRNQNSQISTEKVNQLQKQLDE
TNALLRTESDAAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFLNLQSA
LESERRDRTHGSEMISDLQGRISGLEEDLKNGKILLAKIELEKRQLQERFTDLEKEKSNM
EIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTL
KQKVENLLLEAEKRCSLLDCDLKQSQQKLSELLTQKDVLNEDVRNLTLKIEQETQKRCLT
QNDLKMQTQQVSSLRVSEKQLRQENSHLTEVRVSLEKQNAELRKERQDADGQMKELQDQL
EAEQYFSTLYKTQVKELKEECEEKTKLCKELQQKKQELQDERDSLAAQLEITLTKADSEQ
LARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTGDVANLA
SEKEELNNKLKDAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKE
PVKRGSDTDMRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQ
MTLDSKDSDIEQLRSQLQALHTGLDSSSIGSGPGDAEADDGFPVHITQSHTMKSMSFTYQ
RSSTSLNVASKPSRSHMVSDSDSDSEDALSYLPLPSERNGPESRLEGWLSLPVRNNTKKF
GWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIF
QILYANEGESKKEQEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPP
PALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKI
PKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKQRLLDLAFRDWDWSFDDVDGDD
DDDDDGDVFDF
NT seq 4176 nt   +upstreamnt  +downstreamnt
atgaaggcagaagactatgatgttgttaaagttattggaagaggtgcttttggtgaagtc
cagttggttcgtcataaggcatcacagaaggtttatgccatgaagcttcttagtaagttt
gaaatgataaaaagatcagattctgcttttttttgggaagaaagagatattatggccttt
gccaacagtccctgggtggttcagctcttctgtgcctttcaggatgacaggtatctgtac
atggtaatggaatacatgcctggtggagaccttgtaaacctgatgagtaattatgatgtg
cctgaaaagtgggccaaattctatactgcggaagttgttcttgccctggatgcgatacac
tccatgggcctgatccacagggacgtgaagcctgacaacatgctactggataaacacgga
catctcaaattggcagatttcggcacgtgtatgaagatggatgaaacaggcatggtacat
tgtgatacagcagttggcacacctgattacatatcccctgaggtcctgaagtcacaaggg
ggtgatggctactacggacgggaatgtgactggtggtctgtgggtgttttcctttttgag
atgctagtgggagacactccattttatgcagattcacttgtaggaacttacagtaaaatt
atggatcataaaaattcactatgtttccctgaagatgcagaaatttctaaacacgcgaag
aatctcatctgcgccttcttaacagatagggaggtacgacttgggcgaaatggggtagaa
gaaatcaaacagcatcctttctttaagaatgatcaatggaattgggataacataagagag
acggcagctcctgtggtccctgaactcagcagtgacatagacagcagcaattttgacgac
attgaagatgataaaggcgatgtggaaaccttcccgattcctaaagcttttgtgggaaac
cagctgccttttataggatttacctactatagagagaatttgttattaagtgactcccca
tcttgtagagaaaatgattctgtacaatcaaggaaaaatgaagaaagtcaagagattcag
aaaaaattatatacattagaagaacaccttagcaatgagttacaagccaaagaggagctg
gagcagaagtgcaaatctgttaattctcgcctggagaaaacagcaaaggagctagaagaa
gagatcaccttaaggaaaactgtggagtccgcactgagacaactggaaagagaaaaggcg
cttcttcagcacaagaacgcagagtatcagcgcagggctgagcatgaagcggacaggaaa
cgaaacctggaaaacgatgttaacagcttaaaagatcagcttgaggatttgaaaagaaga
aatcagaattcccaaatatccactgagaaagtgaatcaactccagaaacaactggatgaa
accaatgctttgctgcgaacagaatctgatgctgcagcccgattaagaaaaacacaggca
gaaagttcaaaacagatccagcagctggaatccaacaacagagatctacaagataaaaac
tgcctgctggagactgccaagctgaagcttgaaaaggagtttcttaaccttcagtcagct
ctggagtctgagaggagggaccgcactcacggatcagagatgatcagtgatttgcaaggt
agaatatctggcctagaagaagacttaaagaatggcaaaatcttattagcaaaaatagaa
ctggagaagaggcaactacaggagagattcactgatttggaaaaggaaaagagcaacatg
gaaatagacatgacataccaactaaaagttattcagcagagcttagaacaagaagaagct
gaacataagaccacaaaagcacggttagcagataaaaataagatctatgaatccattgaa
gaagctaaatcagaagccatgaaagaaatggagaagaagctcttggaggaaaggacatta
aaacagaaagtggagaacctgttgctggaagctgagaaaagatgctccctgttagactgt
gacctcaaacagtcacagcagaagctgagtgagctcctcacacagaaagatgtgctgaac
gaagatgttagaaacctgacattaaaaatagagcaggagacccagaagcgctgcctcacc
cagaacgacctgaagatgcagacgcagcaggtgagcagcctgagggtgtcggagaagcag
ctgcggcaggagaacagccacctcacggaggtgagagtgagcctggagaagcagaacgcg
gagctccgcaaagaacgtcaggacgcagatgggcaaatgaaagagctccaggatcagctg
gaagcagaacagtatttctcaaccctttataaaacacaagtcaaggaacttaaagaagaa
tgtgaagagaagaccaaactttgtaaagaattacagcagaagaagcaagaactgcaggac
gaaagggactccttggccgcccagctggaaatcaccttgaccaaagcagattcggagcag
ctggcacgctccatcgctgaagagcagtactccgacttagagaaggagaagatcatgaag
gagctggagatcaaggagatgatggctagacataaacaggagctcactgagaaagatgcc
accattgcctctcttgaagaaaccaacagaacactaactggtgatgttgccaatctcgcg
agtgagaaggaagaattaaacaacaagttgaaagatgctcaagagcagctgtcacggctg
aaggacgaggagatcagcgcagcggcgattaaagcgcagtttgagaagcagctgctgaca
gaaagaacgctcaagactcaggccgtgaataagctggctgagatcatgaatcgaaaagaa
cctgtcaaacgtggtagtgacactgatatgcgcagaaaagagaaggagaataggaagcta
cacatggagcttaaatctgaacgtgaaaaactgacccagcagatgatcaaatatcagaaa
gaactgaatgaaatgcaggctcaaatagctgaagagagccagatccggattgaactgcag
atgaccctggacagtaaagacagcgacatcgagcagctgcgctcacagctgcaggccttg
cacactggtctggacagttcgagcatcggcagcgggcccggagacgctgaggcggatgat
ggctttccagtccacatcactcagtcccacactatgaagtccatgtcgttcacctaccag
cgctcctccacttccctcaatgtggcctctaagccctccaggtctcacatggtctctgac
tctgactctgactcagaagacgctttgtcttacttaccccttccatcggaacgtaatggc
ccagaatcaagattagaaggatggctttcattacctgtgcgcaataacactaagaagttt
ggatgggttaagaagtatgtgattgtaagcagtaagaagattcttttctatgacagtgaa
caggataaagaacaatctaacccttacatggtgttagatatagacaagttgtttcacgtg
cggccagtcacacagacggatgtctatagagcagatgccaaagaaatcccaaggatattc
cagattctgtatgccaatgaaggagagagtaaaaaggaacaagaatttccagtggagcca
gtgggagaaaaatctaattacatttgtcacaaaggacatgaatttattcctactctttat
cacttcccaaccaactgtgaggcttgtatgaagccattgtggcacatgtttaagccccct
ccagcgttagagtgccggcgctgccatatcaaatgtcacaaagatcacatggacaaaaag
gaggagatcatagctccttgcaaagtgtactatgatatttcgacggcaaagaatctgttg
ttattagcaaattctacagaagagcaacagaagtgggttagtcggttggtgaaaaagata
cctaaaaaacccccagccccagatccttttgcacggtcttctcctagaacttcaatgaag
attcagcagaaccagtccatcagaaggccaagtcgacagcttgccccaaacaaacaaaga
ttgcttgatttggcatttagagactgggattggtcgtttgatgatgttgatggtgatgat
gatgatgatgatgatggcgatgtttttgatttctga

DBGET integrated database retrieval system