KEGG   Oryctolagus cuniculus (rabbit): 100009225
Entry
100009225         CDS       T03373                                 
Symbol
UBA1
Name
(RefSeq) ubiquitin like modifier activating enzyme 1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100009225 (UBA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100009225 (UBA1)
   05022 Pathways of neurodegeneration - multiple diseases
    100009225 (UBA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100009225 (UBA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009225 (UBA1)
Enzymes [BR:ocu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     100009225 (UBA1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   100009225 (UBA1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100009225 (UBA1)
  Exosomal proteins of other body fluids (saliva and urine)
   100009225 (UBA1)
  Exosomal proteins of colorectal cancer cells
   100009225 (UBA1)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_UFD E1_FCCH E1_4HB PAZ DUF1186
Other DBs
NCBI-GeneID: 100009225
NCBI-ProteinID: NP_001075840
Ensembl: ENSOCUG00000008376
UniProt: Q29504
LinkDB
Position
X:32306129..32322158
AA seq 1058 aa
MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLPQVPSAPTNGMAKNGSEADIDEGLYSRQLY
VLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLRE
EDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNSPLEDQLRVGEFCH
SRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSTMVSMVTKDNPGVVTCLDEARH
GFESGDFVSFSEVQGMTELNGNQPIEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKK
ISFKSLSASLAEPDFVMTDFAKFSRPAQLHIGFQALHKFCAQHSRPPRPRNEEDAAELVT
LARAVNSKASSAVQQDSLDEDLIRNLAFVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI
MQWLYFDALECLPEDKESLTEDKCLPRQNRYDGQVAVFGSDLQEKLGRQKYFLVGAGAIG
CELLKNFAMIGLGCGENGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVHQMN
PHIRVTSHQNRVGPDTERIYDDDFFQTLDGVANALDNVDARMYMDRRCVYYRKPLLESGT
LGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPA
ENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQLPQSWADCVTWACHHWHTQYSN
NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVSNPLHLDYVMAAANLFAQTYGLAG
SQDRAAVATLLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPPADRHKSKLIAGKIIPAIATTTAA
VVGLVCLELYKVVQGHRHLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVS
RVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgtccagctcgccgctgtccaagaaacgtcgcgtgtccgggcctgatccaaagccgggt
tctaactgctcccctgcccagtccgtgttgccccaagtgccctcggcgccaaccaacgga
atggcgaagaacggcagtgaagcagacatcgatgagggcctttactcccggcagctgtat
gtgttgggccatgaggcgatgaagcggctccagacatccagcgttctggtgtcaggcctg
cggggcctgggggtagagatcgcgaagaacatcatccttggcggggtcaaggccgtgacc
ctccatgaccagggcacggcccagtgggctgacctctcctcccagttctacctgcgagag
gaggacatagggaaaaaccgcgctgaggtgtcacagccccgccttgctgaactcaatagc
tacgtgcctgtcaccgcctacactgggccgctggttgaggacttcctcagtggcttccag
gtggtggtcctcactaacagccccctggaggaccagctgcgcgtgggcgagttctgtcat
agccgtggcatcaagctggtagtggcagacacgagaggcttgtttgggcaactcttctgc
gactttggagaggaaatgatcctcacagattccaacggggagcagcccctcagcaccatg
gtttctatggtcaccaaggacaaccctggtgtggttacctgcctggatgaggcccgacat
gggtttgagagtggcgattttgtttccttctccgaagtacagggcatgactgagctcaat
ggaaaccagcccatagagatcaaagtcctgggtccttacacctttagcatctgtgacacc
tccaacttctccgattacatccgtggaggcattgtcagccaggtcaaagtacctaagaag
ataagctttaaatccttgtcagcctcgctggcagagcctgactttgtgatgacggacttc
gccaagttttctcgccccgctcagcttcacattggcttccaggccttgcacaagttctgt
gcacagcacagccggccacctagaccccggaacgaggaggatgcagcagagctggtgacc
ctagcacgcgctgtgaactctaaagcctcgtcggcagtgcagcaagatagcctggatgag
gacctcatccggaacctggcctttgtggcagccggggacctggcgcccatcaatgccttc
attgggggcctggctgcccaggaagtcatgaaggcctgctctgggaagtttatgcccatc
atgcagtggctgtactttgatgcccttgagtgtctcccggaggacaaagaatccctcaca
gaggacaagtgcctcccgcgccagaaccgttatgatgggcaggtggctgtgtttggctca
gacctgcaagagaagctgggcaggcagaagtacttcctggtgggtgcaggggctattggc
tgtgagctgctcaagaactttgccatgattgggctgggctgtggtgagaacggagaaata
attgtcacagacatggacaccattgagaaatctaatctgaaccgacagtttctattccgg
ccctgggatgtcacgaagttaaaatctgacacagctgctgcagctgtgcaccagatgaat
ccacatatccgggtgacaagccaccagaaccgtgtgggtcctgacactgaacgtatctac
gacgacgatttcttccaaactctggatggcgtggccaacgccttagacaacgtggatgcc
cgcatgtacatggaccgccgctgcgtgtactaccggaagccgctgctcgaatcaggcacc
ctgggcaccaagggcaacgtccaggtggtgatccccttcctgacagagtcctacagctcc
agccaagacccacctgagaagtccatccccatctgtaccctgaagaacttccccaacgcc
atcgaacacactcttcagtgggctcgggatgaatttgaaggcctcttcaagcagccagcg
gaaaatgtcaaccagtacctcacagaccctaagtttgtggagcggacattgcggctggcg
ggtacccagccactggaggtgctggaggctgtgcagcgcagcctggtgctgcagctaccg
cagagctgggcagactgtgtgacctgggcctgccaccactggcacacccagtattctaac
aatatccggcagctgttgcacaacttccctcccgaccagctcacaagctcgggagctccc
ttctggtctgggcccaaacgttgtcctcacccactcacctttgatgttagcaaccctctg
catctggactatgtgatggctgctgccaacctgtttgcccagacctacgggctggcaggc
tctcaggaccgagctgctgtggccacactcctgcagtctgtacaggtccccgagtttacc
cccaagtctggcgtcaaaatccacgtttctgaccaggagctgcagagcgccaatgcttct
gttgacgacagccgtttagaggagctcaaggctacgctgcctagccccgacaagctccct
ggattcaagatgtaccccattgactttgagaaggatgatgatagtaactttcacatggac
ttcattgtggccgcatccaacctccgggccgaaaactatgacattccccctgcagaccgg
cacaagagcaagctgattgcagggaagatcatcccagccattgccacgaccacagcagct
gtcgttggccttgtgtgtctggagctgtacaaggtagtgcagggacaccgacacctcgac
tcctacaagaatggtttcctcaacctggccctgccgtttttcggtttctctgaacctctg
gctgcaccacgtcaccagtactataaccaagagtggacattgtgggatcgctttgaggtt
cagggactgcagcccaacggtgaggagatgaccctcaaacaattcctcgactactttaag
acagagcacaaattggagattaccatgctgtcccagggtgtgtccatgctctattccttc
tttatgccagctgcgaagctcaaggaacggttggaccagccgatgacagagattgtaagc
cgtgtgtcgaagcgaaagctgggccgccacgtgcgggcgctggtgcttgagctgtgctgc
aacgacgagagcggcgaggacgtcgaagtcccctacgtccgatataccatccgttaa

KEGG   Oryctolagus cuniculus (rabbit): 100338238
Entry
100338238         CDS       T03373                                 
Symbol
UBA7
Name
(RefSeq) ubiquitin like modifier activating enzyme 7
  KO
K10698  ubiquitin-activating enzyme E1-like [EC:6.2.1.45]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338238 (UBA7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100338238 (UBA7)
   05022 Pathways of neurodegeneration - multiple diseases
    100338238 (UBA7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338238 (UBA7)
Enzymes [BR:ocu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     100338238 (UBA7)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   100338238 (UBA7)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_UFD E1_4HB
Other DBs
NCBI-GeneID: 100338238
NCBI-ProteinID: XP_002713402
Ensembl: ENSOCUG00000006595
UniProt: G1SRB4
LinkDB
Position
9:complement(17331964..17341461)
AA seq 1008 aa
MRAPGPSQLLDEELYSRQLYVLGPPAMQRMREAKVLLSGLQGLGAEVAKNLVLMGVGSLT
LHDPCPTCWSDLAAQFLLSERDLGRSRAEASRELLAQLNEAVQVSVHLGDITEAFLLDFQ
VVVLTASKLEEQLKVGAWCHEHGVCFLVADSRGLVGQLFCDFGENFTVQDPTEAEPLTAT
IQHISQGCPGILTLRRETVPHSFRDGHLVTFSGIEGMVELNGCDPQPIRVQEDGSLEIGD
TATFSRYLRGGTVIEVKRAKTVNHKPLETALLQPQVMASSSQHRVHCLHQAFRALHKFQD
LHGRPPQPWDPVDAEAVVCLARALGPLKGTDEEPLEEPLDEALVRITALSSAGSLSPMAA
LLGAVAAQEVLKAILGKFMPLDQWLYFDALDCLPENGDILPKPEDCVPRGCRYDGQIAVF
GAGFQEKLSRQHYLLVGAGAIGCELLKGFALVGLGAGGGGSVTVADMDHVERSNLSRQFL
FRPQDIGRPKAEVAAVAAQRLNPDLQVTPLTYPLDPTTEHVYGDHFFSRVNGVAAALDSF
QARHYVAARCTHYLKPLLEAGTEGTKGSAAVFVPDVTEGYKASGLAEDTSYPVCTVRHFP
STAEHTLQWARDEFEGLFRLSAETINRARQAHTSLADMDGPQTLALLRPVLGVLKARPQN
WEDCVVWAHGHWQLRFHYGIIQLLSHIPPDRVLEDGTLFWSGLKQCPQPLEFDMDQENHL
LFVLAAANLYARMHGLPGSLGLAALKGLLLKSLPQTDPQRLAPILTRAPERDQASAEFGP
ELLKELQEVLGVWSEHPALNPLMFEKDDDSNFHMDFVVAAANLRSQNYGIPPVTRAQGKQ
IVGRIIPAIATTTAAVAGLVGLELYKVVGGSRTLGAYRHSYLHLAENRLLRWVPSAPAIQ
MFQSLEWTCWYRLKVSAGQPEKSLQWLLAHLQEQHGLRVKMLLHGTALLYSASWSPAKQA
QFLPLSVTELVQQVTGRAHEPGLRVLVLELSCEGEEEDTAFPPLHYEL
NT seq 3027 nt   +upstreamnt  +downstreamnt
atgcgcgccccggggccctcccagttactggatgaggagctctactccaggcagctgtat
gtgcttggcccacctgccatgcagaggatgcgggaagccaaggtgctgctgtcaggcctg
cagggccttggggctgaggtggccaagaacctggtcctgatgggtgtgggcagcctcact
ctgcatgatccctgtcctacctgctggtctgacctggccgcccagtttttgctctcagag
cgggacttgggaaggagcagagctgaagcctctcgggaactcttggctcaactcaatgaa
gctgtccaggtgtctgtccatctgggtgacatcaccgaggccttcctgctggacttccag
gtggtggtactgacggcctcaaagctggaagagcagctgaaggtgggcgcctggtgccac
gagcatggagtctgcttcctggtggccgatagccggggcctcgtggggcagttgttctgt
gattttggtgaaaacttcactgtccaggaccccaccgaggcggaaccactgacagccacg
attcagcacatctcccagggctgccctggcattctcactctgcgaagagagactgtcccc
cactccttccgtgatgggcacttggtgactttctcaggcattgaaggcatggttgagctc
aatggctgtgatccccagcccatccgtgtgcaggaggacgggtccttggagattggggac
acagcaaccttctcccgttacttgcgtggcgggactgtgatagaagtcaagagagctaag
accgtgaatcacaaacccctggaaacagccctgctgcagccccaggtcatggcctcgagt
tctcagcaccgtgtccactgcctgcatcaggccttccgtgcgctgcacaaattccaggac
ctccatggccggccgccgcagccctgggatcctgttgatgcagaggctgtggtgtgcctg
gcccgggccctgggaccactgaaggggacagacgaagagccgttggaagagccactggat
gaggccctagtgcggatcactgctttgagcagtgctggcagcttgagccccatggcagcc
ttgctgggtgcagtggctgcgcaggaagtgctgaaggcaatcttggggaagttcatgccc
ttggaccagtggctgtactttgatgctctcgactgtcttccggaaaatggggacatcctt
cccaaacctgaggactgcgtcccgagaggctgccgctatgatgggcaaatagctgtgttt
ggggctggatttcaggagaaactgagccgccagcactacctcctggtaggtgctggcgcc
attggctgtgagctgctcaagggctttgccctagtgggcctgggagctgggggcggcgga
agtgtgactgttgccgacatggaccacgtagaacgctccaacctcagccgtcagttcctg
ttcaggccccaggacattggtagacccaaggcagaagtggctgctgtagctgcccagcga
ctgaacccagacctacaggtgactccactcacctacccgctggatcccaccacagagcat
gtctacggggaccactttttctcacgtgtgaatggcgtggctgctgccctggacagtttc
caggcccggcactatgtggctgctcgctgcacccactatctgaaaccactgctggaggca
ggcacagagggcaccaaaggcagtgctgcagtgttcgtgccagacgtgaccgagggctac
aaagcctcgggcttagctgaggacacctcctaccccgtctgtaccgtgcggcatttcccg
agcacagctgagcacaccctgcagtgggctcgggatgagtttgagggactcttccggctg
tctgcagagaccatcaaccgcgcccgacaggcacacacttccctggcagatatggacggg
ccacagacactggccttattgcggccagtgctaggtgtcctgaaggcacggccacagaac
tgggaagactgcgtggtgtgggcccatggccactggcagctgcgcttccactatggcatc
atccagctgctgagtcatatcccccctgatagagtgcttgaagatggaactctgttctgg
tcgggtctcaaacagtgtccccagcccctggaatttgacatggaccaagaaaaccacctc
ctcttcgtgctggcagctgccaacctgtatgcgcgaatgcatggcctacccggctcgctg
ggcctcgctgcactcaaagggctgctgctgaagtcgctgccacagactgaccctcagcgg
ctggcccccatcctcactagggctccagagagggatcaggcttctgctgagtttggccct
gagctgttgaaggagttgcaggaggtcctgggagtatggagcgagcaccctgctctgaac
cctctgatgtttgagaaggatgatgacagcaacttccacatggattttgtggtggcagca
gctaacctgcgatctcagaactatgggatcccacctgtcactcgggcccagggcaagcaa
attgtgggccggattatcccagccatcgccaccactacagcagcagtggcaggcctggtg
ggcctggagctatataaggtagtaggtgggtcacggacccttggtgcctatcgtcacagc
tatctgcacctggctgaaaaccgcctccttcgctgggtaccttccgcaccagccatccag
atgttccagagcctggagtggacctgttggtaccgcctgaaggtgtctgctgggcagccc
gagaagagcctgcagtggctgttggcccatctccaggagcaacatgggctgagggtgaag
atgctgctgcatggcacggccctgctgtattcagccagctggtcacctgcaaagcaggcc
cagttcctgcccctcagcgtgacagaactcgttcagcaggtgacaggccgtgcgcatgag
cctggcctgcgggtactggtcctggagctgagctgtgagggcgaagaggaggacactgcc
ttcccacctctgcactatgagctctga

KEGG   Oryctolagus cuniculus (rabbit): 100356574
Entry
100356574         CDS       T03373                                 
Symbol
UBA6
Name
(RefSeq) ubiquitin like modifier activating enzyme 6
  KO
K10699  ubiquitin-activating enzyme E1-like protein 2 [EC:6.2.1.45]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100356574 (UBA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100356574 (UBA6)
Enzymes [BR:ocu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     100356574 (UBA6)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   100356574 (UBA6)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_4HB E1_UFD
Other DBs
NCBI-GeneID: 100356574
NCBI-ProteinID: XP_008266023
Ensembl: ENSOCUG00000012827
LinkDB
Position
15:82001343..82079580
AA seq 1010 aa
MYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKALTIHDTEKCQAWDLG
TNFFLCEDDVINMKNRAEAVLQHIAELNPYVHVTSSSVPFNETTDLSFLDQYQCVVLTEM
KLPLQKKINDFCHSHCPPIKFISADIHGIWSRLFCDFGDEFEVSDTTGEEPKEIFISNIT
QANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSTQQITVVSPFSFSICDTTELEPY
LHGGIAVQVKTPKMFYFEPLERQIKHPKCLIADFSKPEVPLQIHTAMLALDQFQENYSRK
PNIGCQQDSEELLKLATSISETLEEKPDINVDIVRWLSWTARGFLSPLAAAVGGVASQEV
LKAVTGKFSPLCQWLYLEAADIVESLDRPECEEFLPRGDRYDALRACIGNTLCQKLQNLN
IFLVGCGAIGCEMLKNFALLGVGTSKEKGMVTVTDPDLIEKSNLNRQFLFRPYHIQKPKS
YTAADATLKINPQLKIDAHLNKVCPATETIYNDEFYTKQDIIITALDNVEARRYVDSRCL
ANLRPLLDSGTMGTKGHTEVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWAR
DKFESSFSHKPSLFNKFWQTYPSAEDVLQKMQNGHSLEGCFQVIKLLSRRPRNWSQCVEL
ARLKFEKYFNHKALQLLHCFPLDTRLKDGSLFWQSPKRPPSPIKFDLNEPLHLSFLQNAA
KLYATVYCIPFTEEGLSADALQNILAEVKIEEFKPSNKVVQTDETARKPEHVPVSSEDER
NAVFQLEKAISSNEATKSDLQMAVLSFEKDDDSNGHIDFITAASNLRAKMYSIEPADRFK
TKRIAGKIIPAIATSTAAVSGLVALEMIKVAGGYPFEAYKNCFLNLAIPILVFTETTEVR
KTEIRNGISFTIWDRWTIHGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHA
KRLKLTMHKLVKPSTEKKYVDLTVSFAPDTDGDEDLPGPPVRYYFSHDSD
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgtatagtcgccagaggtatgttcttggagacacagcaatgcagaagatggccaagtcc
catgttttcttaagtggtatgggtggtctcggtttggaaattgcaaagaatcttgttctt
gctgggattaaggcacttacaatccatgatacagaaaaatgccaggcatgggatctagga
accaacttctttctctgtgaagatgatgttattaatatgaaaaacagggctgaagctgta
cttcaacatattgcagaactaaatccatatgtgcatgttacgtcatcatctgttcctttc
aatgaaaccacagatctttcattcttagatcaataccagtgtgtagtattgactgaaatg
aaactccccttgcagaagaagatcaatgacttctgccattctcactgccctccaattaag
ttcatcagtgcggatatacatggaatttggtcacgcttgttttgtgattttggtgatgaa
tttgaagtttcagatacaacaggagaagaaccaaaagaaattttcatttcaaacataaca
caagctaatcctggcattgtcacttgccttgaaaatcatcctcacaaacttgagacagga
cagttcctaacatttcgagaaattaatggaatgacaggtttaaatggatcgacacaacaa
ataactgtggtatcaccattttcttttagcatttgtgacactacagaactagaaccatat
ttacatggtggcatagctgtccaagtgaaaactcctaaaatgttttactttgagccattg
gagaggcagataaagcatccaaaatgccttatcgcagattttagcaaacctgaggtacct
ctacagattcacacagctatgcttgccttggaccagtttcaggagaactatagtcggaag
ccaaatattggatgccaacaagattcagaagagctgttgaaactggcaacatccataagt
gaaaccttggaagaaaagcctgacataaatgttgacattgtccgttggctgtcttggact
gctcgagggtttttgtccccacttgctgcagctgtaggaggtgttgccagccaagaagtt
ttgaaagctgtgacagggaagttttctcctttgtgccagtggttatatctagaggcagca
gatattgtcgaatccctagacagacctgaatgtgaagaatttcttccacgaggagatagg
tatgatgccttaagagcgtgcattggaaacactttgtgtcagaagctacaaaatttgaat
atcttcttagtaggatgtggagccataggctgtgaaatgttgaaaaattttgctttactt
ggtgttggcacaagcaaagagaaaggaatggtcacagttactgatcctgacttgatagaa
aaatccaatttaaataggcagttcctatttcgtccttaccacatacagaaacctaaaagc
tatactgctgctgatgcgactctgaaaataaatcctcaactaaaaatagatgcacacctg
aacaaagtatgtccagccactgagaccatttacaatgatgagttctatactaagcaagat
ataattattacagcattagataatgtggaagccaggagatatgtagacagccgctgctta
gcaaatctacgacctctcttagattctggaacaatgggcactaagggacacacagaagtt
attgtacctcatttgactgagtcttacaatagtcatcgggatcccccagaagaggaaata
ccattttgtactctaaaatcctttccggctgctattgaacatactatacagtgggcaaga
gataagtttgaaagttccttttcccataagccttcactgtttaacaaattttggcaaacc
tatccatctgcagaagatgtcttacagaagatgcaaaatggacacagcttagaaggttgt
tttcaagttattaagttacttagcagaagaccaagaaactggtctcagtgtgtagaatta
gcaagattaaaatttgagaagtattttaaccacaaggctcttcagcttcttcattgtttt
cccctagacacaagattaaaagatggcagtttattttggcaatcaccaaagaggccacct
tctccaataaaatttgatttaaatgaacctttgcacctcagttttcttcagaatgctgca
aaactatatgctacggtgtattgcattccatttacagaagagggcttatcagcagacgcc
ctccagaatattcttgcagaagtaaagattgaggagttcaagccttccaataaggttgtt
caaacagatgaaacagcaaggaaaccagagcatgttcctgttagcagtgaagatgagagg
aatgctgttttccagctggaaaaggctatttcatctaatgaagctaccaaaagtgacctt
caaatggcagtgctttcctttgaaaaggatgatgatagtaatggacacatagatttcatc
acagcggcctccaatcttcgtgccaaaatgtatagcattgaaccagctgaccgtttcaaa
acaaagcgaatcgctgggaaaattatacctgccatagcaacatctactgctgcggtttct
ggcttggttgccctggagatgatcaaagtggctggtggctatccatttgaagcttacaaa
aattgttttcttaacctagccattccaattctagtgtttacagagacaactgaagtgaga
aaaactgaaatcagaaatggaatctcatttacaatttgggacagatggactatacatgga
aaagaagatttcaccctattggatttcataaatgcagtaaaagagaagtacggcattgaa
ccaacaatggtggtacagggagtcaaaatgctttatgttcctgttatgcctggtcatgca
aaaagattgaaattaacaatgcataaacttgtgaaaccttctactgagaagaaatacgtg
gatcttactgtgtcgtttgccccagatactgatggagatgaagatttgccaggacctcca
gtaagatactacttcagtcatgacagtgattaa

DBGET integrated database retrieval system