Oryctolagus cuniculus (rabbit): 100009272 Help Entry 100009272         CDS       T03373                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu03082   ATP-dependent chromatin remodeling ocu04015   Rap1 signaling pathway ocu04145   Phagosome ocu04210   Apoptosis ocu04390   Hippo signaling pathway ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04810   Regulation of actin cytoskeleton ocu04814   Motor proteins ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04971   Gastric acid secretion ocu05014   Amyotrophic lateral sclerosis ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05135   Yersinia infection ocu05164   Influenza A ocu05205   Proteoglycans in cancer ocu05225   Hepatocellular carcinoma ocu05410   Hypertrophic cardiomyopathy ocu05412   Arrhythmogenic right ventricular cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05416   Viral myocarditis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100009272 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100009272 (ACTB)    04390 Hippo signaling pathway     100009272 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100009272 (ACTB)   09143 Cell growth and death    04210 Apoptosis     100009272 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100009272 (ACTB)    04520 Adherens junction     100009272 (ACTB)    04530 Tight junction     100009272 (ACTB)   09142 Cell motility    04814 Motor proteins     100009272 (ACTB)    04810 Regulation of actin cytoskeleton     100009272 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100009272 (ACTB)    04613 Neutrophil extracellular trap formation     100009272 (ACTB)    04670 Leukocyte transendothelial migration     100009272 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     100009272 (ACTB)    04919 Thyroid hormone signaling pathway     100009272 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     100009272 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     100009272 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100009272 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100009272 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     100009272 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     100009272 (ACTB)    05135 Yersinia infection     100009272 (ACTB)    05100 Bacterial invasion of epithelial cells     100009272 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100009272 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100009272 (ACTB)    05410 Hypertrophic cardiomyopathy     100009272 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     100009272 (ACTB)    05414 Dilated cardiomyopathy     100009272 (ACTB)    05416 Viral myocarditis     100009272 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ocu03021]     100009272 (ACTB)    03019 Messenger RNA biogenesis [BR:ocu03019]     100009272 (ACTB)    03036 Chromosome and associated proteins [BR:ocu03036]     100009272 (ACTB)    03029 Mitochondrial biogenesis [BR:ocu03029]     100009272 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ocu04812]     100009272 (ACTB)    04147 Exosome [BR:ocu04147]     100009272 (ACTB) Transcription machinery [BR:ocu03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100009272 (ACTB) Messenger RNA biogenesis [BR:ocu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100009272 (ACTB) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100009272 (ACTB)     NuA4 complex      100009272 (ACTB)   Chromatin remodeling factors    BAF complex     100009272 (ACTB)    PBAF complex     100009272 (ACTB)    GBAF(ncBAF) complex     100009272 (ACTB)    SWR1 complex     100009272 (ACTB) Mitochondrial biogenesis [BR:ocu03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100009272 (ACTB) Cytoskeleton proteins [BR:ocu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100009272 (ACTB) Exosome [BR:ocu04147]  Exosomal proteins   Proteins found in most exosomes    100009272 (ACTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100009272 NCBI-ProteinID:  NP_001095153 Ensembl:  ENSOCUG00000005867 UniProt:  P29751 LinkDB All DBs AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEERPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatatcgccgcgctcgtggtcgacaatggctccggcatgtgcaaggccggc ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgtccgcggcac cagggcgtgatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcccagagc aagcgtggcatcctgacgctcaagtacccgatcgagcacggcatcgtgaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagcttcgcgtggcgcccgaggaa cgcccggtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc cagatcatgttcgagacgttcaacacgccggccatgtacgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccacgggcatcgtgatggactctggcgacggggtcacc cacacggtgcccatctacgagggctacgcgctgccgcacgccatcctgcgtctggacctg gccggccgggacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc accaccacggccgagcgcgagatcgtgcgggacatcaaggagaagctgtgctacgtggcg ctggacttcgagcaggagatggccacggccgcgtcctcctcctccctggagaagagctac gagctgcccgacggccaggtcatcaccatcggcaacgagcgcttccgttgccccgaggcg ctcttccagccctccttcctgggcatggagtcgtgtggcatccacgagaccaccttcaac tcgatcatgaagtgcgacgtggacatccgcaaggacctgtacgccaacacggtgctgtcg ggcggcaccaccatgtaccccggcatcgccgaccgcatgcagaaggagatcaccgccctg gcgcccagcaccatgaagatcaagatcatcgcgcccccggagcgcaagtactcggtgtgg atcggcggctccatcctggcctcgctctccaccttccagcagatgtggatcagcaagcag gagtatgacgagtcgggcccctccatcgtgcaccgcaagtgcttctag

DBGET integrated database retrieval system